KEGG   Anthracocystis flocculosa: PFL1_01702Help
Entry
PFL1_01702        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp04011  MAPK signaling pathway - yeast
pfp04139  Mitophagy - yeast
pfp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    PFL1_01702
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    PFL1_01702
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    PFL1_01702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfp01001]
    PFL1_01702
Enzymes [BR:pfp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PFL1_01702
Protein kinases [BR:pfp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PFL1_01702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 19315827
NCBI-ProteinID: XP_007877403
Position
Unknown
AA seq 360 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSAKDQLTNTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHIRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDVWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDEVIKT
ICSENTLRFVQSLPKRERIPFSQKFRNADPMALDLLEKMLVFDPRTRISAAEALAHPYLA
PYHDPTDEPEAEEAFDWSFNDADLPVDTWKVMMYSEILDFHNIDNSGQDEGPVPPQAGQA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgactttgtcaagctctcgattttcgggaccgtctttgaggtcaccacccgctat
gtcgacctgcagccggtcggcatgggcgctttcggcctcgtttgctccgcaaaagaccag
ctcaccaacacctcggtcgccatcaagaagatcatgaagcccttcagcacgcccgtgctc
agtaagaggacctaccgagagctcaagctgctcaagcacatcaggcatgagaacatcatc
agcctgagcgatatcttcatctcgccgctcgaagacatctacttcgtcacggagctcctc
ggaaccgacctgcaccgcctgctgacgagcaggccgctcgagaagcaattcatccagtac
ttcctgtaccagatcctccgcggtctcaagtatgttcactcggccggcgtcgttcaccgc
gatctgaaaccgagcaacatcctggtcaatgagaactgcgatctgaagatctgcgacttc
ggactggcgcgcatccaggacccgcagatgacgggctacgtcagcacccgctactaccga
gcgcccgagattatgctgacgtggcagaagtacgacgtcgcagtggacgtctggagtgcg
ggatgcatctttgccgagatgctcgagggcaagccgttgttcccaggaaaggatcacgtc
aaccagttctcgatcatcactgagctgctcggtacgcctccggacgaggtcatcaagacg
atctgctccgagaacacgctgcgcttcgtccagtcgctgcccaagcgcgagagaattccg
ttttcgcaaaagttccgcaacgccgatccgatggcgctcgacctgttggagaagatgctc
gtctttgacccgaggacacgcatcagcgccgccgaggcgcttgcgcacccctacctggcg
ccgtaccacgaccccaccgacgagcccgaggccgaagaggcgtttgactggagcttcaac
gatgccgacctgcccgtcgacacgtggaaggtgatgatgtactcggagatccttgacttc
cacaacatagacaactcgggccaggacgagggtccggttccgcctcaggccggccaagcc
tga

DBGET integrated database retrieval system