KEGG   Anthracocystis flocculosa: PFL1_02239Help
Entry
PFL1_02239        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00450  Selenocompound metabolism
pfp00970  Aminoacyl-tRNA biosynthesis
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PFL1_02239
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFL1_02239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfp01007]
    PFL1_02239
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfp03016]
    PFL1_02239
Enzymes [BR:pfp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PFL1_02239
Amino acid related enzymes [BR:pfp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PFL1_02239
Transfer RNA biogenesis [BR:pfp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PFL1_02239
 Prokaryotic type
   Other AARSs
    PFL1_02239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 WHEP-TRS Anticodon_1 DZR Noelin-1
Motif
Other DBs
NCBI-GeneID: 19316360
NCBI-ProteinID: XP_007877943
Position
Unknown
AA seq 740 aa AA seqDB search
MASPFPVALPVSETRAHNDSPSVLMKVTTETSAKNQKILPQQGEPNILVTSALPYVNNVP
HLGNIIGSTLSADVYARYSRTRNRNTLYICGTDEYGTATETKALEDGVTPQQLVDKYHAV
HAKVYEWFQLGFDHFGRTTTPKQTEIAQDIFLKLHENGYLEEKSMTQLFCEQCTRFLADR
YVEGICPKCGYDDARGDQCDKCGQLLDAIELVKPRCKVCSSAPIQKESRHMFLRIDNLQP
LTEKWARAAAEAGGWSSNGRQITESWFREGLRPFSLTRDLKWGVPVPIKGMEDKVLYVWF
DAPIGYPSITANYTDDWQQWWKNPDNVKLYQFMGKDNVRFHTVIFPSCLIGTKEPWTMLH
HISTTEYLQYEGGKFSKSRNVGVFGDKAGELGLSPSVWRYYLLANRPETADSQFAWRDFI
ARNNSELLANLGNFCNRVLTFMKKYDLTVPEIPAGSELRTYKEGPLVAAPPAGEDGSASV
IAKYVRDVNALLAQYIEAMEAVKIRSGLQHMMALSARSNLFLVEMGFDNTLFTERREQCD
EVMLVTLNVIWLLSVLIHPFMPETCDSILKQLDAPPRAVPDDGRFQLDLLPGHRIGKAAH
LFKRIDEAEEDVWRAQFGGSSDAKDAAKADAPAMSKKQAMKAAKAAKKAAEERNKVVVKN
KTPELLDLEARVASQGDRVKQLKDQTKKEAEAEQKQKLEKETETELKALLEMKTELSELT
SRLAKLEMDAEVPASAPAPQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccctttcccgtggcgctccccgtctcggagacgagggcgcacaacgactcg
ccctcggtgctcatgaaggtcaccaccgagacctcggccaagaaccagaagatcctgccg
cagcagggcgagcccaacatcctcgtcacctcggcgctgccctacgtcaacaacgtgccc
caccttggcaacatcatcggttccaccctcagcgccgacgtctacgcccgctactcgcgc
acgcgcaaccgcaacacgctctacatctgcggcaccgacgagtacgggacggccaccgag
acaaaggcgctcgaggacggcgtcacgccgcagcagctcgtcgacaagtaccacgccgtc
cacgcaaaggtctacgagtggttccagctcggcttcgaccactttggcaggaccacgacg
cccaagcagaccgagatcgctcaggacatcttcctcaagctgcacgagaacggctacctc
gaggagaagagcatgacgcagctcttctgcgagcagtgcacgcgcttcctggccgaccga
tacgtcgagggcatctgccccaagtgcgggtacgacgatgcgcgcggcgaccagtgcgac
aaatgcggccagctcctcgacgccatcgagctggtcaagccgcgctgcaaggtgtgctcg
tcggcgcccatccagaaggagtcgcgccacatgttccttcgcatcgacaacctccagccg
ctcacggaaaagtgggcccgcgctgccgccgaggccggcggctggtcgtcgaacggccgg
cagatcaccgagagctggttccgcgaggggttgcggccctttagcctgacgcgcgacctc
aagtggggtgtgcccgtccccatcaagggcatggaggacaaggtgctctacgtgtggttc
gacgcgcccatcggctacccgagcatcacggccaactacaccgacgactggcagcagtgg
tggaagaatccggacaacgtcaagctctaccagttcatgggcaaggacaatgtgcgcttc
cacaccgtcatcttcccgtcgtgcctgatcggcacaaaggagccgtggaccatgctccac
cacatcagcaccaccgagtacctccagtacgagggcggcaagttttccaagtcgcgcaac
gtcggcgtctttggcgacaaggcgggcgagctcggcctgtcgccgagcgtgtggcgctac
tacctgctggccaaccggcccgagacggccgacagccagttcgcgtggcgcgactttatc
gcccgcaacaactcggagctgctggccaacctgggcaacttctgcaaccgcgtgctgacc
ttcatgaagaagtacgacctcaccgtgcccgagatccctgccggttcggagctgcggacg
tacaaggagggtcccctggtggcggcgccccccgccggcgaggacggctcggcgtcggtg
attgccaagtacgtgcgcgacgtcaacgcgctgctggcgcagtacatcgaggcgatggag
gcggtcaagatccgctcgggcctgcagcacatgatggcgctctcggcgcgctcgaacctg
ttcctcgtcgagatgggctttgacaacacgctcttcaccgagcggcgcgagcagtgcgac
gaggtgatgctggtgacgctcaacgtcatctggctcctgtcggtgctcatccacccgttt
atgcccgagacgtgcgactcgatcctcaagcagctcgacgcgccgccgcgcgccgtgccc
gacgacggccggttccagctggacctgctgcccggccaccggatcggcaaggcggcgcac
ctgttcaagcgcatcgacgaggcggaggaggacgtgtggcgcgcccagtttggcgggtcg
agcgacgccaaggacgccgccaaggccgacgcgcccgccatgtccaagaagcaggccatg
aaggcggccaaggcggccaaaaaggcggccgaggagaggaacaaggtcgtggtcaagaac
aagacgcccgagctgctcgacctcgaggcgcgggtggcgtcgcagggcgaccgggtcaag
cagctcaaggatcagacgaaaaaagaggccgaggccgagcagaagcagaagctggaaaag
gagaccgagacggagctcaaggcgctcctcgagatgaagactgagctgtccgagctgacg
agccggctagccaagctcgagatggacgccgaggtgcctgcgtctgcacccgcaccgcag
tag

DBGET integrated database retrieval system