KEGG   Anthracocystis flocculosa: PFL1_03991Help
Entry
PFL1_03991        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    PFL1_03991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 CDC45 EABR
Motif
Other DBs
NCBI-GeneID: 19318098
NCBI-ProteinID: XP_007879705
UniProt: A0A061H7R8
Position
Unknown
AA seq 684 aa AA seqDB search
MPHQKRRMQPRIAKASPPMALAPLLALPLPLPLVLLPLLLLLLATIPSSIASSHSVESFT
EHLLLRPLPDGRLQTSFDFHLASDSDSRAHFHLLPRSLLQLVQTHNVDEAHLSLNTGRWD
YNKWGSPVRSVRHEHHRPHGNGNGHGHGHDHDAAAASSWIQVGDDDVAPGAQLWARLRHD
DTPHNGTESATDPFSPPDDVARHWTDLTSSLAGLFCTSLNALDSRSTVMPNLAFHSGARE
SSSAASSPATTTLHAFLPSESICTENLTPLLKLLPCKGHAGLASLLNPLSLFGANFQGMA
VHVVRRTPPASGWHVKLSVQAVFSPAVTRDVSNRDWSLESVFARTLQRSCPLAAQSTIRV
TTPDDQGYVSEHLVDPLPARPARPSVRDHADFVDPDEDDDAREDGDERHDGDDDDDDDAA
ASASIPRRGASDAAWQKYWSERGEYVYDVTSLSAYSGSGSASSAGSASSASNASNASGSG
GESGKAGLNIAMTWPKEQRFRYPDAIAPPRVAVSRILSGSGQQRSVLTTTVRNNDVRRAA
SLVYLETLPWFLQPQLHTLRTHVDADAYDDQRDAYVRFVDEVTSDPVREIVYQPSVDRQR
PFVLEMRIVVPPRTTVRIQVECRRRQGRGQGRQRRMYTTSNLVELATPDFSFVYTNIIFT
STVIALFFGSTLNGFVRRFRDVVV
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaccagaaacgcaggatgcaaccacggatagcaaaggcgtctccacccatggcc
ctcgcaccgctcctcgccctccctctccccctccccctcgtgctactgccgctgctgctg
ctgctcctggcaacgataccgagcagcatcgcctcgtcgcactctgtcgaatccttcacc
gagcacctcctcctccgtccactcccagatgggcgcctgcagacctcgttcgacttccac
ctcgcctcggactcggactcgcgcgcccacttccacctcctcccgcgctccctcctccag
ctcgtccagacccacaacgttgacgaggcacacctctccctcaacacgggaaggtgggac
tacaacaagtggggcagccccgtgcgctccgttcgacacgagcaccaccggccacacggc
aacggcaacggccacggccacggccacgaccacgatgccgccgctgcttcctcctggatc
caggtcggagacgacgatgtggcaccgggcgcgcagctctgggcaaggctgcgccacgac
gacaccccgcacaacggcacagagagcgcaacggaccccttttcccctcccgacgacgtc
gcgcgccactggaccgacctcacctcgtccctcgccggcctcttttgcacctcgctcaac
gccctcgactcgcgctccaccgtcatgcccaacctcgccttccacagcggcgccagagaa
tcgtcgtcggcagcctcgtcgcccgccaccacgacgctgcacgcctttctgccgtccgag
tcgatctgcacggaaaacctcacgccgctgctcaagctgctgccgtgcaagggccacgcc
gggctagcgtcgctcctcaacccgctctcgctctttggcgcaaacttccagggcatggcc
gtccacgtcgtccgccgcacgccgcccgcctccgggtggcacgtcaagctctcggtccag
gccgtctttagccccgccgtgacgcgcgacgtcagcaaccgcgactggagcctcgagtcg
gtgtttgcgcgcaccctgcagcgcagctgcccgctcgccgcccagagcaccatccgcgtc
acaaccccagacgaccagggatacgtctcggagcacctcgtcgacccgctccccgccaga
cctgcccggccctcggtgcgcgaccatgccgacttcgtcgacccagacgaagacgacgac
gcgcgagaggatggcgacgagcgccacgacggcgacgacgacgacgacgacgacgctgcc
gcctcggcctcgataccccgccgcggcgcatccgatgccgcgtggcaaaagtactggtcg
gagcggggcgagtacgtgtacgacgtcacctcgctttcggcctacagcggcagcggcagc
gccagcagcgccggcagcgccagcagcgccagcaacgccagcaacgccagcggcagcggc
ggcgagagtggcaaagcgggcctcaatatcgccatgacgtggcccaaggagcaacggttc
cggtatccggacgccatcgcgccgccgcgggtggcggtatcgcgcatcctctccgggtcg
gggcagcagcggtcggtgctgacgacgacggtgcgcaacaatgacgtgcggcgcgccgcc
tcgctcgtgtacctcgagacgctgccgtggtttctgcagccgcagctgcacacgctgcgc
acgcacgtcgacgccgacgcgtacgacgaccaacgcgacgcctacgtccgcttcgtggat
gaagtcacctcggacccggtgcgagagatcgtctaccagccttcggtggatcggcaacgc
ccctttgtgctcgagatgcgcatcgtcgtccccccgcgcaccacggtacgcatccaagtc
gagtgccgccgccgccagggacgaggacaagggcgacaacgacggatgtacacgacgtcg
aacctcgtcgagctggccactccggacttttcctttgtctacaccaacattatcttcacc
tcgaccgtcattgccctctttttcggcagtaccctcaacggcttcgtgcgccgcttccgc
gatgtcgtcgtgtag

DBGET integrated database retrieval system