KEGG   Anthracocystis flocculosa: PFL1_05827Help
Entry
PFL1_05827        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K14565  nucleolar protein 58
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    PFL1_05827
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfp03009]
    PFL1_05827
Ribosome biogenesis [BR:pfp03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    PFL1_05827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 19319912
NCBI-ProteinID: XP_007881556
UniProt: A0A061H3R2
Position
Unknown
AA seq 588 aa AA seqDB search
MVKVLFETAVGFCLFNLSDSAKLQSPDLHKSFSTPEAANNLLKLSAIHRFTSTAEAVEDV
SALNEGKMSKSLKKFLTEEIVDAADGKGKSKENLIVAESKLASTIAKKLGIQVTYDSELL
DLYRGIRENLASLLSSSSSSDGSLDPRDLNTMSLGLSHSLSRYKLKFSPDKVDTMVVQAI
GLLDDLDKEINIYAMRVKEWYGWHFPEMGKIITDNLAYAKVIRAMGFRTNASATDFSEVL
PEEIEETLKAAAEISMGTEISETDLEHIWSLCDQVISISQYRAQLFQYLQNRMAAIAPNL
TALVGDLVGARLISHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTPKYGLIYHASL
VGQASQKLKGKMARMVATKAALSIRLDALADADTKSEEGAPSIGLEARAKLESRLRALEM
QGGVSGMRGARHAAGDSGYKQKAFKMDDAGRSYNASADAPVAVSTSNGVKDMASAAALAP
PATPASDDKKEMTKEEKKAAKKARKSLAAGSEPATPAADGDAELTKEERKALKKQRKEAE
AAAAAAAEGLPETPSKKSKKDKKRSADDVDGTPATDKKKSKKSKKSDE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggttctcttcgagacagccgtcggcttctgcctgttcaacctgtcggacagc
gccaagctgcagtcgcccgacctgcacaagagcttctcgacgcccgaggcggccaacaac
ctgctcaagctctcggccatccaccgcttcaccagcaccgccgaggcggtcgaggacgtg
tcggcgctcaacgagggcaagatgagcaagagcctcaaaaagttcctcaccgaggagatt
gtcgacgccgccgacggcaagggcaagtccaaggagaacctcattgtcgccgaatccaag
ctggcctcgacgattgccaagaagctgggcatccaggtcacgtacgactcggagctcctc
gacctctaccgcggcatccgcgagaacctcgcttcgctcctctcgtcgtcgtcgagcagc
gacggctccctcgacccgcgcgaccttaacaccatgagcctcggcctgtcgcacagcctc
agccgctacaagctcaagttcagcccggacaaggtcgacaccatggtcgtccaggccatc
ggcctgctcgacgacctcgacaaggagatcaacatctacgccatgcgcgtcaaggagtgg
tacggctggcacttccccgagatgggcaagatcatcaccgacaacctcgcctatgccaag
gtcatccgcgccatgggcttccgcaccaacgcgtcggccaccgactttagcgaggtgctg
cccgaggagattgaggagacgctcaaggccgccgccgagatctcgatgggcactgagatc
tccgagaccgacctcgagcacatctggagcctgtgcgaccaggtcatctccatctcccag
taccgcgcccagctgttccagtacctccagaaccgcatggccgccatcgcgcccaacctg
acggcgctcgtcggcgacctggtcggcgcccgcctcatcagccacgccggcagcctcatg
aacctcgccaagcacccggcctcgaccgtccagatcctcggcgccgaaaaggccctcttc
cgcgcgctcaagaccaagcacgacacgcccaagtacggcctcatctaccacgccagcctg
gtcggacaggcgtcgcagaagctcaagggaaagatggcgcgcatggtcgcgaccaaggcg
gcgctctcgatccgcctcgatgcgctcgcagatgccgacaccaagtccgaggagggagcg
ccgagcatcggcctcgaggcgcgggccaagctcgagtcgcggctgcgcgcgctcgagatg
cagggcggcgtcagcgggatgcgcggggcgaggcacgccgcgggcgacagcggctacaag
cagaaggccttcaagatggacgacgcggggcgcagctacaacgcctcggccgacgcgccc
gtcgccgtcagcacgagcaacggcgtcaaggacatggccagcgccgccgcgctcgcgccg
cccgccacgccggcatcggacgacaagaaggaaatgacaaaggaggaaaagaaggcggcc
aagaaggcgagaaagtcgctcgccgccgggtcggagccggccacgcccgccgccgacggc
gacgccgagctcaccaaggaggagcgcaaggcgctcaagaagcagaggaaggaggccgag
gcagccgccgccgccgccgccgagggcctgccagagacgccgagcaagaagagcaagaag
gacaagaagcggagcgccgacgacgtcgacggcacgccagcgaccgacaagaagaagagc
aagaagagcaagaagagcgacgagtga

DBGET integrated database retrieval system