KEGG   Anthracocystis flocculosa: PFL1_06434
Entry
PFL1_06434        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00910  Nitrogen metabolism
pfp01100  Metabolic pathways
Module
pfp_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pfp_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PFL1_06434
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PFL1_06434
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 NIR_SIR_ferr Rieske Rubredoxin_C DAO FAD_binding_2
Other DBs
NCBI-GeneID: 19320510
NCBI-ProteinID: XP_007882166
UniProt: A0A061H1J4
Position
Unknown
AA seq 1160 aa
MAPIPTEVAYTPTDSLSHCCSSSESGIDNAPLTRATTPDSSASSVAGRRRHAVVVGLGMV
GIAFVEKLLKYDLEGGREEWQVTVIGEEPHIAYNRVGLTQYFTNRSIEALYLNPLAWYSS
HAKGKLTYHTSDPAVAIDAEAKVVKTAKGLEIEYDECILATGSDAALPPYISRKRFFETK
GTFVYRSIQDLDDIIGYAQDAPSTLGRRIRKAAVIGGGLLGLEAAKALLDLDEVDQVVLV
ERNRWVLSRQLDQEGGTMVLDKVRDLGVEVLLQARVRDLQWDGTDRLTGMVLEAKDGKPE
EVFEVDMLVFAVGIKARDELATSITPYSPAIHKRGGGFVVDTRLSTSIPHLYAIGECASF
LDQTFGLIAPGVEMAEVLAFNLTEGPHHKLRDMKAPDVSTKLKLMGVDVASFGDFFADQG
KISKPLPSAGRAAARKGAIAIPPPEEVKKQVKALTYRDPFSDVYKKYIFTADGKYLLGGM
MVGDVKDYIKLVSLTTKGMAIEKPPAELIVGAKKEGEDEGADLPDDAQICSCHNVTKGMV
VQCVKDGGIRSFGEMKASTKCGSGCGGCVPLATSIFNKALKEAGVEISNHLCAHFAYSRQ
ELFQIVKFKKLKDFSTVMRTVGKTPNSLGCEACRPAVGSILSSLYNEWIMQPSLRQTQDT
NDRYLANVQRDGTYSVVPRLPAGEVTPAGLKAIGEVADKFKLYTKITGGQRIDMFGAKKQ
DLPAIWEILVDAGFESGHAYGKALRTVKSCVGSTWCRYGVGDSVGLAHELESRYKGIRAP
HKFKGGVSGCVRECAEAQGKDFGLIATTKGWNVYLGGNGGAKPRHAELVAEDVTKRQAIK
ILDRFIIFYIRSADKLERTARWIEKFPGGIKGLKEVIVDDKLGICADLEKEMEVLVGTYH
CEWTNVVKDPLRKKAFKQFVNTDETQAVSEMITEREQQRPADWPVDSSPLRFSVLDVAKS
APWEFRPVCRLSDLDRQDDSPTSATIKYGDVQIAVWNIPGRGLRAAQNMCPHRRAFVLSD
GLIGEDAKGRDYVSCPLHKRNYLLSAKSDEEGGNCTNDGDYSIMTFETRADEETDTVYLR
LPPTDALDAVLSTSKWMLRKATEESDLIAGGQSHSIEITGPLSDAETASKQRPSSSDSQP
SSSSPAAPKKASCGESALDW
NT seq 3483 nt   +upstreamnt  +downstreamnt
atggcgccaattccaacagaagtggcctacacgcccaccgactcgctctcacattgttgc
tcgagctccgaatccggcatcgacaatgcacccctcacaagagcgacaacaccagactcg
tccgcctcgtcggtcgcaggcaggaggaggcacgccgtcgtcgtcggcctcggcatggtc
ggcatcgcctttgtcgagaagctgctcaagtacgacctcgaaggcggccgcgaagagtgg
caggtgaccgtcatcggcgaggagccccacatcgcctacaaccgcgtcggactcacccag
tactttaccaaccgcagtatcgaggcgctctacctcaacccgctcgcctggtactcgtcg
cacgccaagggcaagctcacataccacacctcggaccccgcagtggccatcgacgccgag
gccaaggtcgtcaagacggcaaagggcctcgagatcgagtacgacgagtgcatcctggcc
accggctccgacgcggcattgccaccctacatctcgcgcaagcgcttcttcgagaccaag
ggcaccttcgtctaccgcagcatccaggatctcgacgacatcatcggctacgctcaagac
gcaccaagcacgctcgggcggcgcatccgcaaggcggcggtcatcggcggcggcctcttg
ggcctcgaagctgcaaaagcgctcctcgacctcgacgaggtcgaccaggtggtgctggtc
gagcgcaaccgctgggtgctcagccggcagctggaccaggagggcggtaccatggtgctc
gacaaggtgcgcgacctcggcgtcgaggtcctccttcaggcgagggtgcgcgaccttcag
tgggacgggacggaccgcctcactggcatggtgctcgaggccaaggacggcaagccagaa
gaggtctttgaggtcgacatgctcgtctttgccgtcggtatcaaggcgcgcgacgagctg
gccacctccatcacgccctactcgcccgccattcacaagcgcggcggcggattcgtggtc
gacacccgcctcagcacgtcgatcccgcacctctacgccattggcgagtgcgcatccttc
ctcgaccagaccttcggcctgatcgcgcccggcgtcgagatggccgaggtgctcgccttc
aacctcaccgagggcccgcatcacaagctgcgcgacatgaaggcgccggacgtcagcacc
aagctcaagctgatgggcgtcgatgtggcctcgttcggagacttcttcgccgaccagggc
aagatcagcaagccgctcccctcggccggccgggccgctgcaaggaagggcgccatcgcc
atcccgccgcccgaagaggtcaagaagcaggtcaaggccctcacctaccgcgaccccttc
tcggacgtctacaagaagtacatcttcaccgccgacggcaagtacctgctcggcggcatg
atggtcggcgacgtaaaggactacatcaagctcgtcagcctcacaaccaagggcatggcg
atcgagaagccgcccgccgagctcatcgtcggcgccaagaaggagggcgaggacgagggc
gccgacctgcccgacgacgcccagatctgcagctgccacaacgtcaccaagggcatggtg
gtgcagtgcgtcaaggacggcggcatccgctcctttggcgagatgaaggccagcaccaag
tgcggctccggctgcggcggctgcgtgcccctcgccaccagcatcttcaacaaggcgctg
aaggaggccggcgtcgagatctccaaccacctctgcgctcacttcgcctactcccgccag
gagctcttccagatcgtcaagttcaagaagctcaaagacttctcgacggtcatgcgaacg
gtgggcaagacgcccaacagcctcggttgcgaggcgtgccggccggcggtgggcagcatc
ctcagctcgctctacaacgagtggatcatgcagccctcgctgcggcagacgcaggacacc
aacgaccgctacctcgccaacgtgcagcgcgacggcacctacagcgtggtcccccggctg
ccggcgggagaggtgacgccggccggcctcaaggcgatcggcgaggtggcggacaagttc
aagctgtataccaagatcaccggcggccagcgtatcgacatgtttggcgccaagaagcag
gacctgccggccatctgggagatactggtcgacgccggcttcgagagcggtcacgcgtac
ggcaaggcgctgcgcaccgtcaagtcgtgcgtcggcagcacgtggtgccggtacggcgtc
ggagactcggtcggcctggcgcacgagctcgagtcgcgctacaagggcattcgcgcgccg
cacaagttcaagggcggcgtctcgggctgcgtgcgcgagtgcgccgaggctcagggcaag
gactttggcctgatcgccaccaccaagggctggaacgtctacctgggcggcaacggcggc
gccaagccgcgccacgccgagctcgtcgccgaggacgtgaccaagcggcaggccatcaag
atcctcgaccgcttcatcatcttctacatccgctcggccgataagctcgagcggacggcg
aggtggatcgaaaagttccccggcggcatcaaggggctcaaggaggtcatcgtcgacgac
aagctgggcatctgcgccgatctggaaaaggagatggaggtgctggtcggcacctaccac
tgcgaatggaccaacgtggtcaaggatccgctgcgcaagaaggccttcaagcagtttgtc
aacaccgacgagacccaagcggtctcggagatgatcaccgagcgcgagcagcagcggccg
gccgactggcccgtcgacagcagcccgcttcgcttcagcgtgctcgacgtggccaagtcg
gcgccgtgggagttccggccggtctgccgcctctcggacctggacaggcaggacgactcg
ccgacgagcgccacgatcaagtacggcgacgtccagatcgccgtgtggaacatccccggg
cgcggtctgcgggcggcgcagaacatgtgcccgcaccggcgcgcgtttgtgctcagcgac
ggcctgatcggcgaggacgcaaaggggcgcgactacgtctcgtgcccgctgcacaagcgc
aactaccttctcagcgccaagtccgacgaggagggcggcaactgcaccaacgacggcgac
tactcgatcatgacgttcgagaccagggccgacgaggagaccgacaccgtctacctccga
ctcccgcccaccgacgccctcgacgccgtcctctcgacgtccaagtggatgctgaggaag
gccaccgaggagtcggacctcatcgccggtgggcagtcgcactcgatcgagatcaccggc
cccctcagcgacgccgagacggcttccaagcagcgcccgtcctcgtccgactctcagccc
tcttcttcttcgccggctgcgccaaagaaggcgtcttgcggcgagagcgccctagactgg
tag

DBGET integrated database retrieval system