KEGG   Pragia fontium: QQ39_08220Help
Entry
QQ39_08220        CDS       T03952                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pfq  Pragia fontium
Pathway
pfq00740  Riboflavin metabolism
pfq00790  Folate biosynthesis
pfq01100  Metabolic pathways
pfq01110  Biosynthesis of secondary metabolites
pfq02024  Quorum sensing
Module
pfq_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    QQ39_08220 (ribA)
   00790 Folate biosynthesis
    QQ39_08220 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    QQ39_08220 (ribA)
Enzymes [BR:pfq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     QQ39_08220 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AKJ42075
UniProt: A0A0G3CMX3
Position
complement(1844725..1845315)
Genome map
AA seq 196 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGHDHVALIFGDISDDKPVLARIHSECLTGDAL
FSLRCDCGFQLEAALQHIAEEGRGILLYHRQEGRNIGLLNKIRAYALQDLGADTVEANHQ
LGFAADERDFTLCADMFKLLDVSAVRLLTNNPKKVEILTEAGINIVERVPLLVGRNPKNE
KYLDTKAAKMGHLLSK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaaaaagagtggcggaagcaaaattaccaacaccatggggcgattttctgatg
gtggggtttgaagagcttgccacggggcatgaccatgtcgccttgatatttggcgatatt
agcgacgataagccagtgttggctcgtattcactcagaatgtctgactggtgatgcgcta
tttagtttacgttgtgactgtggttttcagctggaagccgcattacaacacatagcggaa
gaaggccgtggtattttactttatcaccgtcaggaaggtcgcaatattggcttgctgaat
aagattcgtgcttacgcactacaagatctcggcgcggataccgttgaagctaatcaccaa
ttgggctttgctgctgatgaacgggactttactctctgtgccgatatgttcaagcttttg
gatgtgagcgcagtacgtctgttaaccaataatccgaagaaagtagagatcttgactgaa
gcgggcatcaatattgttgaacgagtaccgctgctggttggacgtaacccgaaaaacgaa
aaatatcttgatactaaagccgccaagatgggccatttactatccaaataa

DBGET integrated database retrieval system