KEGG   Pragia fontium: QQ39_16330Help
Entry
QQ39_16330        CDS       T03952                                 

Definition
(GenBank) sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
pfq  Pragia fontium
Pathway
pfq00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    QQ39_16330
Enzymes [BR:pfq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     QQ39_16330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer ARD
Motif
Other DBs
NCBI-ProteinID: AKJ43428
UniProt: A0A0G3CTZ6
Position
complement(3737467..3738030)
Genome map
AA seq 187 aa AA seqDB search
MNNKRLAVKKQYQEKTVEFLLKAYIQLTDNEKNNIEIAHFGLPDYPRSGLQLLTYFNDAR
YCAKELVLFPNQVCPEHRHPPFEGKTGKQETFRCRWGEVYLLVDDDSLTLNQDKQGNPIY
SPPEGDEQWYRCDRFIVLTPGQQYTIPPDTLHWFKAGPNGAVVSEFSSESRDEFDVFTDP
RVKRLED
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaacggttggccgtgaaaaaacaatatcaagagaaaacggttgagttttta
ttgaaagcatatattcaactgactgataatgaaaaaaataatattgaaattgcgcatttc
ggattacctgattatccacgttcagggttacagttactgacatactttaatgacgcaaga
tattgtgccaaagagctggtgctctttcccaatcaggtctgccctgagcatagacatcct
ccctttgaaggaaagaccggtaagcaggaaacattccgctgccgttggggagaggtttat
ttgttggtggatgatgattcgttaacattaaatcaagataaacaaggaaatccgatttat
agcccgccagaaggtgatgagcagtggtatcgctgcgatcgttttatcgtattaacaccg
ggtcaacaatacacgatcccacctgatacgctacactggtttaaagctgggccaaatggg
gccgtggtttctgagttttcaagcgaaagtcgtgatgaattcgatgtttttaccgatcca
cgggtaaagcgtttagaagattga

DBGET integrated database retrieval system