KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_20310Help
Entry
PFREUD_20310      CDS       T01252                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I (GTP-CH-I)
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00790  Folate biosynthesis
pfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFREUD_20310 (folE)
Enzymes [BR:pfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PFREUD_20310 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: CBL57524
UniProt: D7GG63
Position
complement(2188331..2189008)
Genome map
AA seq 225 aa AA seqDB search
MSESTRAGRSDETRETDATDHAIDNSAYEQPGLELPPGFDGKRIEAAMREVLIGIGEDPD
REGLVETPARIARAYGEIFSGLGKEPDKVLARTFDISHDEMVLVRDIDVHSMCEHHLLPF
HGRAHVCYIPAKDGRVTGLSKLARLVDLYARRPQVQERLTTQMANALVDQLGARGVLVVL
ECEHQCMTMRGVRKPGSTTVTSAVRGVLRDPATRSEAMSLIVRNR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaatccacgcgcgccggccggtccgacgagacccgcgaaactgacgccaccgac
cacgccatcgacaattcggcctacgagcagcccggcctcgaactgccccccggcttcgac
gggaagcgcatcgaggcggccatgcgcgaggtgctcatcggcatcggcgaggaccccgac
cgcgagggcctggtggagacgccggcccgcatcgcgcgtgcctacggcgagatcttctcg
ggcctgggcaaggaacccgacaaggtgctggcgcgcaccttcgacatcagccatgacgag
atggtgctggtgcgcgatattgacgtgcactccatgtgcgaacaccacctgctgcccttc
cacggacgggcccatgtctgctacatccccgccaaggacggccgcgtgaccggcctgtcg
aagctggcgcgcctggttgacctgtacgcccggcgtccccaggtgcaggagcgcctcacc
acgcagatggccaatgccctggtcgaccagctgggcgcgcgcggcgtgctcgtggtgctg
gagtgcgagcaccagtgcatgacgatgcgcggggtgcgcaagcccggcagcaccaccgtc
accagcgccgtgcgtggcgtgctgcgtgacccggccacccgctccgaggccatgagcctc
atcgtgcgcaaccgctga

DBGET integrated database retrieval system