KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_0659Help
Entry
RM25_0659         CDS       T03860                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
pfre00450  Selenocompound metabolism
pfre00970  Aminoacyl-tRNA biosynthesis
pfre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RM25_0659
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RM25_0659
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfre01007]
    RM25_0659
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfre03016]
    RM25_0659
Enzymes [BR:pfre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RM25_0659
Amino acid related enzymes [BR:pfre01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RM25_0659
Transfer RNA biogenesis [BR:pfre03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RM25_0659
 Prokaryotic type
   Other AARSs
    RM25_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJQ90386
Position
768411..770357
Genome map
AA seq 648 aa AA seqDB search
MPVGRSVSSARLSRRQACDLLPAPLGPRAAAGPAGPRACVDTNAVPTILGAMCAHILATA
AWPYANGPRHIGHVSGFGVPSDVFARYMRMSGNDVLLVSGSDEHGTAIQVKADAEGLTAQ
ETADKYHRIIVEDLQGLGLSYDLYTRTTTLNHEAVTQEVFRTLYDNGYIIEKTQLGAISP
STGRTLADRYIEGTCPICGYEFARGDQCDNCGNQLDPIDLINPHSRIDGEVPDFVETTHF
FLDLPALAEELMTWLNSRKDWRPNVLNFSYNFAKELKPRAITRDLDWGIPIPVEGWENDD
MKRIYVWFDAVIGYLSGSIEWARRTGDPDAWKAWWQDPEARSYYFMGKDNIVFHSVIWPS
MLLGLNGEGSRGGTPSKWLGKLDLPTEVVSSEFLTMKGSKVDTSHGVVIYVGDFLREFGP
DTLRYYIAVAGPENKDTDFTWDEFVRRNNNELANEWGNLVNRSLSMAFKNNGEIPPAHEL
LNVDAELLASSKAAFITVGKLIEECKFKAAITEAMRVVATANQYISQQEPWKLGDDTDRR
DTVLNTALQVVSDANTLLTPFMPHSAQKIFEMLGGTGVWAAQPEIREVSEGEGDQEHSYP
VLMGDYDSAQAVWQSLPIKVGTPLTKPVPLFRKLDEALAENGPEWAKL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgggcagatccgtctcatcggcgaggctatcgcgccggcaggcgtgcgacctg
ctgccggccccgctgggtccacgagcggctgccggccccgccgggccgcgggcgtgcgtc
gacaccaatgccgttcccactattctgggggccatgtgcgctcatattcttgccacggcc
gcgtggccctatgccaacggcccccgccatatcggtcacgtctcgggtttcggggtgccc
tccgatgttttcgcacggtatatgcgcatgtccggtaatgacgtcctgctcgtgtcgggt
tccgatgagcacggcacggccatccaggtgaaggccgatgccgaggggctcaccgcccag
gagaccgccgacaagtaccaccgcatcatcgtggaggacctgcaggggctgggcctgtcg
tacgacctgtacacacggaccacgacgctcaaccacgaggccgtcacccaggaggtgttc
cgcaccctctacgacaatggctacatcatcgagaagacccagctcggggccatctcgccg
agcacgggtcgcacgctggccgaccgctatatcgagggcacctgccccatctgcggctat
gagttcgcccgcggcgaccagtgcgacaactgcgggaaccagcttgatccgatcgacctg
atcaatccgcactcccgtattgacggtgaagttcccgatttcgtggagaccacgcatttc
ttcctcgaccttcccgcactcgccgaggaactgatgacctggctgaactcacgcaaggac
tggcgtcccaatgtgttgaacttcagctacaacttcgccaaggagctcaagccgcgggcc
atcacccgtgacctcgactggggcatcccgatcccggttgagggctgggagaacgacgac
atgaagcgcatctacgtgtggttcgacgccgtgatcggttacctgtcgggttccatcgaa
tgggcgcggcgcaccggcgaccccgatgcctggaaggcctggtggcaggaccccgaggcc
cgcagctactacttcatgggcaaggacaacatcgtcttccactcggtgatctggccctcc
atgctgttggggctcaacggtgagggttcgcggggcggcacgcccagcaagtggctcggc
aagctcgacctgcccaccgaggtggtcagctcggagttcctcacgatgaagggctccaag
gtggacaccagccacggtgtggtgatctatgtgggcgacttcctgcgcgaattcggaccc
gacacgctgcgctattacattgcggtggccggcccggagaacaaggacaccgatttcacc
tgggatgaattcgtgcggcgcaacaacaatgagctcgccaatgagtggggcaatctcgtg
aaccgctccttgtcgatggccttcaagaacaatggcgagattccgccggcccatgagctg
ctcaatgtcgacgccgagctgctggccagctcgaaggcggcattcatcacggtgggcaag
ctcatcgaggagtgcaagttcaaggcggcgatcaccgaggcgatgcgcgtggtggccacc
gccaatcagtacatcagccagcaggagccgtggaagctcggcgatgacaccgatcggcgc
gacaccgtgctcaacaccgccctgcaggtggtgtccgatgcgaacacgctgctcaccccg
ttcatgccgcattcggcacagaagatcttcgagatgttgggcggcaccggcgtgtgggcg
gcccagcccgagatccgtgaggtgtcggagggcgagggcgaccaggagcacagctacccc
gtgctgatgggtgactatgactcggcccaggcggtctggcagtcgttgcccatcaaggtc
ggcaccccgctgaccaagccggtgccgttgttccgcaagctggacgaggcactggccgag
aacggtccggagtgggccaagctctga

DBGET integrated database retrieval system