KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_1077Help
Entry
RM25_1077         CDS       T03860                                 

Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
pfre00270  Cysteine and methionine metabolism
pfre00920  Sulfur metabolism
pfre01100  Metabolic pathways
pfre01110  Biosynthesis of secondary metabolites
pfre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RM25_1077
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RM25_1077
Enzymes [BR:pfre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     RM25_1077
    2.3.1.46  homoserine O-succinyltransferase
     RM25_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AJQ90794
Position
1244448..1245701
Genome map
AA seq 417 aa AA seqDB search
MGHPGDGDDAASASRGIPGMTSSRHQYLPPTPEDIVETKFMDLFDTPGEPMHLVRGGTLP
GITVAYETYGTLNERRDNAIYICHALTGDAHAAGYHEGDDRPGWWDALIGPGKAIDTDRW
FVVASNILGGCSGTTGPSSVNPETGKPYGLDFPLLDMHDFVVVHRALLTKLGVPHLHAAV
GGSLGGMQVLDWALTHPEDMNQAVVIASSSRLTAQNIAFSAVGREAIMSDENFMNGAFAE
NDTNPDVGLAVARMMAHITYTSEEGFEEKFGRRPQFDAQQPGFGVDFAVESYLDHQASSF
IGRFDALSYLYLTRVMDYFNPFADAHALDRLVATPVRFLVMSFDSDWRFGTAHSRRIVRR
LQDAALPVSFREIHAPWGHDSFLLHIPPYLDSVRAFVEQPAVPRPTIRRRRLRKWGR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggggcatccgggcgatggcgacgacgcggcatccgcgtcgcgggggataccgggcatg
acgtcgagcaggcaccagtacctcccacccacccccgaggacatcgtcgagacgaagttc
atggacctcttcgacaccccgggcgaacccatgcacctggtccgcggcggaaccctgccg
gggatcacggtggcctatgagacctacggcaccctcaacgagcgtcgtgacaacgccatc
tacatctgccatgcactcaccggggacgcccacgccgccggctaccacgagggcgacgat
cgtccgggctggtgggatgccctcatcggacccggcaaggccatcgacaccgaccgctgg
ttcgtcgtcgcctcgaacatcctaggcggctgctccggcaccaccggtcccagcagcgtc
aaccccgagacgggcaagccctacgggctcgacttccccctgctcgacatgcacgacttc
gtcgtcgtgcaccgcgccctgctcaccaagttgggggtgccgcatctgcacgcggcagtg
ggcgggtcgctggggggcatgcaggtcctggactgggccctgacccatcctgaggacatg
aaccaggccgtcgtcattgccagctccagccgactgaccgcacagaacatcgcgttcagc
gccgtcggccgtgaggccatcatgagcgacgagaacttcatgaacggcgccttcgccgag
aatgacacgaatcccgatgtcggccttgcagtggcccggatgatggcccacatcacctac
accagcgaggaggggttcgaggagaagttcggcaggcgtccccagtttgacgcccaacag
ccgggcttcggtgtcgacttcgccgtcgagagctacctggaccatcaggcaagcagcttc
atcgggcgcttcgatgccctgagctatctctacctgacccgcgtcatggactatttcaat
cccttcgccgacgcccatgccctcgaccgtctcgtggcgactccggtgcgcttcctggtg
atgagcttcgactccgactggcgcttcggcacggcccactcccggcgcatcgtgcggcgc
ctgcaggacgcggccctgccggtgagcttccgcgagatccatgcgccgtggggccacgat
tccttcctgctgcacatcccgccctaccttgactccgtgcgggccttcgtcgaacagccc
gcggtgccccgacccacgattcgacgtcgacgactacggaagtggggacgatga

DBGET integrated database retrieval system