KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_1315Help
Entry
RM25_1315         CDS       T03860                                 

Definition
(GenBank) Tyrosine--tRNA ligase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
pfre00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RM25_1315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfre01007]
    RM25_1315
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfre03016]
    RM25_1315
   03029 Mitochondrial biogenesis [BR:pfre03029]
    RM25_1315
Enzymes [BR:pfre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     RM25_1315
Amino acid related enzymes [BR:pfre01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   RM25_1315
Transfer RNA biogenesis [BR:pfre03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RM25_1315
 Prokaryotic type
    RM25_1315
Mitochondrial biogenesis [BR:pfre03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RM25_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C
Motif
Other DBs
NCBI-ProteinID: AJQ91026
Position
complement(1508760..1510028)
Genome map
AA seq 422 aa AA seqDB search
MNALLDDLTWRGFVANSTDRDALAAHLDAGMVTSYVGFDPTARSLHIGHLMQLILARRLQ
QAGHRPLLLIGGSTGLIGDPKMTGERVMNTKETVSAWVASLAEQTKKYVSFEGENGSRIV
NNLDWTGPLSALDFLRDIGKHFSVNRMLARDVVARRLEDGISYTEFSYVLLQSFDYAELH
RLYGCTLQTGAQDQWGNITAGADYIRRTTGDIVHGLVTPLLTKADGTKFGKTEGGTVWLD
PELTSPYAFHQFWLNAEDAKVMDYLKIFSFRSHDELAELAEQTEQAPYKRLAQRALADDV
TDLVHGVEARKAADEAARALFGRGELAALDDATISAVMGEVKATEVSTRDGELPTVVDAL
AASGVVASKSAARRTIQEGGAYVNNAKVTDPDARLSADQLLAGRYAVLRRGKKTVGGVIL
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcgctactcgatgacctgacctggcgaggattcgtcgccaactcgaccgaccgg
gatgccctggccgcccatctggacgccggcatggtcacgagttatgtgggctttgaccct
actgcccgcagcctccacatcggccacctgatgcagctcatccttgcccgacgcctccaa
caggccggacatcgccccctactgctcatcgggggcagcacgggcctgatcggggacccg
aagatgaccggcgaacgggtcatgaataccaaggagaccgtttccgcctgggtggcgagc
ctggccgaacagaccaagaagtacgtgagcttcgagggtgagaacggttcaaggatcgtc
aacaacctggactggaccggtccgctgtcggccctggacttcctcagggacatcggcaag
cacttcagtgtgaaccgcatgctggcccgcgacgtcgtggcacgacgccttgaggacggc
atcagttacaccgagttcagctatgtgctgttgcagtcgttcgactacgcagaactccat
cgcctctacggatgcacactgcaaaccggtgcccaggaccaatggggcaacatcaccgca
ggggccgactacatccggcgcacgaccggcgacatcgtccacgggctcgtgacccccttg
ctgaccaaggcagatggcacgaagttcggcaagacggagggtggcaccgtgtggctggat
cccgagctcacatcgccctatgccttccaccagttctggttgaacgccgaggacgccaag
gtcatggactacctcaagatcttcagcttccgcagtcacgatgaactggccgagttggcg
gaacagaccgaacaggctccgtacaagcggcttgcccagcgggcgctggccgacgacgtg
acggacctcgtgcacggggtcgaggcccgcaaggcagcagatgaggcggcgcgggccttg
ttcggcaggggagagctggcggcactggatgacgcgacgatctccgccgtcatgggggag
gtcaaggcaaccgaggtctccacccgggacggcgagctgccgacggtcgtggatgcactg
gcggccagcggtgtggtcgcctcaaagtcggctgcgcgcaggacgatccaggaaggcggc
gcctacgtcaacaacgcgaaggtgaccgaccctgatgcaaggttgagcgcggaccagttg
ctcgcgggtcgttatgcggtgctgcgacggggcaagaagacggtcggaggcgtgatcctg
acgcggtga

DBGET integrated database retrieval system