KEGG   Pseudomonas fluorescens SBW25: PFLU_3028Help
Entry
PFLU_3028         CDS       T00899                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00071  Fatty acid degradation
pfs00072  Synthesis and degradation of ketone bodies
pfs00280  Valine, leucine and isoleucine degradation
pfs00310  Lysine degradation
pfs00362  Benzoate degradation
pfs00380  Tryptophan metabolism
pfs00620  Pyruvate metabolism
pfs00630  Glyoxylate and dicarboxylate metabolism
pfs00640  Propanoate metabolism
pfs00650  Butanoate metabolism
pfs00900  Terpenoid backbone biosynthesis
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01120  Microbial metabolism in diverse environments
pfs01130  Biosynthesis of antibiotics
pfs01200  Carbon metabolism
pfs01212  Fatty acid metabolism
pfs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLU_3028
   00630 Glyoxylate and dicarboxylate metabolism
    PFLU_3028
   00640 Propanoate metabolism
    PFLU_3028
   00650 Butanoate metabolism
    PFLU_3028
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFLU_3028
   00072 Synthesis and degradation of ketone bodies
    PFLU_3028
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLU_3028
   00310 Lysine degradation
    PFLU_3028
   00380 Tryptophan metabolism
    PFLU_3028
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFLU_3028
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFLU_3028
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFLU_3028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfs04147]
    PFLU_3028
Enzymes [BR:pfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFLU_3028
Exosome [BR:pfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLU_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAY49257
UniProt: C3KAB9
Position
3302770..3303954
Genome map
AA seq 394 aa AA seqDB search
MTDPIVIVSAVRTPMGGFQGDLKSLTAPQLGSAAIRAAVERAGIATDAVDEVLFGCVLPA
GLGQAPARQAALGAGLDKATRCTTLNKMCGSGMEAAILAHDSLLAGSVDVVIAGGMESMS
NAPYLLDRARNGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCALHNSFSREAQDAF
AIASLTRAQEAITHGSFAAEIVPVQVTVGKEQKTIQHDEQPPKAKLDKIGSLKPAFREGG
TVTAANSSSISDGAAALVLMRQSEAQQRGLKPLAVIHGHAAFADEPGLFPVAPVGAIRKL
MTKTGWNLDEVDLFEINEAFAVVSLVTMSKLEIPHAKVNVHGGACALGHPIGASGARILV
TLLSALRQRGLKRGVAAICIGGGEATAMAVECLY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcctatcgttattgtcagcgccgtgcgcacgcccatgggcgggttccagggc
gatctcaagagcctgactgcgccgcagctgggttccgccgcgattcgtgccgccgtcgag
cgcgccggtatcgccaccgatgccgtggatgaagtgctgttcggctgcgtattgcccgcc
ggcctcggccaggcgccggcgcgccaggctgccctgggcgccgggctggacaaggccacg
cgctgcacgaccctcaacaaaatgtgcggctcgggcatggaggcggcgatcctggctcac
gattcactgctggccggcagtgtcgacgtggtgattgccgggggcatggaaagcatgtcc
aacgcaccctacctgctggaccgggcgcgcaacggctaccgcatgggccacggcaaggtg
ctggaccatatgttcctcgacggcctggaagacgcctatgacaaaggccgcctgatgggc
acctttgccgaagactgcgccctgcacaacagtttcagccgtgaagcccaggacgcgttc
gccattgcttcgttgacccgtgcacaagaggccattacccatggcagcttcgccgccgag
attgtcccggttcaggtcaccgtgggcaaagaacagaaaaccatccagcatgatgagcag
ccgcccaaggccaaactggacaagatcggcagcctgaaaccggccttccgcgaaggcggc
accgtgacagcggccaactccagctcgatttccgatggcgcggcggcgttggtgctgatg
cgccagtccgaggcgcagcaacgtggcctcaagcccttggcggtgatccatgggcatgcc
gcgtttgccgatgagccgggtctgttcccggtggcgccggtcggggcaattcgcaaactg
atgaccaagactggctggaacctggatgaggttgatctgttcgagatcaacgaagccttt
gccgtggtcagcctcgtgaccatgagcaagctggaaatcccccacgccaaggtcaatgtc
catggcggcgcctgcgccctgggccatccgatcggcgcatcgggtgcgcggatcctggtg
accttgctctcggccctgcgccagagaggcctcaagcgcggcgtcgccgcgatttgcatc
ggtggtggtgaagccacggccatggccgtcgaatgcctgtattaa

DBGET integrated database retrieval system