KEGG   Pseudomonas fluorescens SBW25: PFLU_4749Help
Entry
PFLU_4749         CDS       T00899                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00260  Glycine, serine and threonine metabolism
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01120  Microbial metabolism in diverse environments
pfs01130  Biosynthesis of antibiotics
pfs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLU_4749
Enzymes [BR:pfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PFLU_4749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 DUF4031
Motif
Other DBs
NCBI-ProteinID: CAY51571
UniProt: C3JXY2
Position
complement(5225073..5226077)
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTPGMLDAMATAASGDDVYGEDPSVNRLEAELAKRLGFAAALFVPTG
TMSNLLALMAHCERGEEYIVGQQAHTYKYEGGGAAVLGSIQPQPLDVQADGSLDLDQVLA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLANARAFTREHGLALHLDGARLYNAAVKLG
VDARAIAQHFDSVSVCLSKGLGAPIGSVLCGSTALIAKARRLRKMVGGGMRQAGSLAAAG
LYALDHQVQRLADDHANALWLGDALREAGYSVEPVQTNMVYVQIGDRADALKAFAAERGI
KLSVAPRLRMVTHMDVSRAQMERVLQAFVEFSPK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgattgacctgcgcagcgacaccgtgacccaacccacccctggcatgctcgat
gcgatggccactgccgccagcggtgatgacgtctacggcgaagaccccagcgtcaaccgc
ctggaagccgagctggccaagcgcctggggtttgccgcggcgttgttcgtgcccaccggc
accatgagcaacctgctggcgttgatggcgcattgtgagcgcggcgaggaatacatcgtc
ggccaacaagcgcacacctacaaatacgaagggggcggggcggcggtgctcggttcgatc
cagccccagcccttggacgtgcaggcggacggctcactggacctggaccaggtgctggct
gcgatcaagccggacgatttccacttcgcccgcacccgcctgctggcgttggaaaacacc
atgcaaggcaaggtgttgccgctggagtacctggcgaacgcccgcgcgttcacccgtgaa
catggcttggccctgcacttggacggcgcgcggctctacaacgcagcggtcaagctggga
gtggatgcgcgcgcgattgcccagcactttgactcggtgtcggtgtgcctgtccaaaggc
ctcggcgcgccgatcggctcggtgctgtgcggctccacggcgctgatcgccaaggcccgg
cgcctgcgcaagatggtcggtggcggcatgcgccaggccggttccctggcggcggcgggg
ttgtatgccctggatcaccaggtacagcgcctggccgatgaccacgccaatgccctgtgg
ctgggggatgcgctgcgcgaggccgggtacagcgtggagccggtgcagaccaatatggtc
tacgtgcagatcggtgaccgggccgatgccctgaaggcctttgccgccgagcgcgggatc
aagctgagcgttgcgccgcggctgcgcatggtcacgcatatggatgtcagccgcgcgcag
atggagcgcgtgctgcaggcatttgtcgagttttcgccaaaatga

DBGET integrated database retrieval system