KEGG   Pseudomonas fluorescens SBW25: PFLU_4794Help
Entry
PFLU_4794         CDS       T00899                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PFLU_4794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAY51637
UniProt: C3JZT2
Position
5275851..5277467
Genome map
AA seq 538 aa AA seqDB search
MATPSLTASTHTSVADPKPRLDKKPSLVTVIIFFAVLAMGLLFTAYSLMHDMHEMGAQLT
TWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTNSLPPHFAVVWSGFFNFLGVLLS
SGAVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSI
IGVGVANALMHGRDGTSGVDWSQAIKIGYALLLSPLIGFAFAAMLLLALRAFVKNRALYK
APKGDTPPPWWIRGMLIATCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPAE
QSLQFAAVAEVTQVALVKSAPQPLSGDPRPILSTYVRTKEATAELVPALAALAGQIGEEV
KGYGSLAKVPAEAVGNVRNDMYLSSETIRLMDKGKVGNFDADTQGKLQLFKQQIDNSTRF
IPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAEMVAMLTIGAADMYG
LPVSTTHVLSSGVAGTMVANGGGLQMRTIRNLAMAWVLTLPAAILLSGSLYWLFTQLF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccttccctgactgcctccacccacacctcagttgcagaccccaaacccagg
ctggacaagaaacccagcctggtgacggtgatcatcttcttcgccgtgctcgccatgggg
ctgttgttcaccgcctacagcctgatgcatgacatgcatgaaatgggcgcccaactcacc
acgtggacgccgtttttgctgctcggcgtggcgctgttgatcgccttgggtttcgagttc
gtcaacggcttccacgacaccgccaacgccgtggcgacggtgatctacaccaactcgctg
ccgccgcatttcgcggtggtgtggtcgggctttttcaacttcctcggcgtgctgctgtcg
agcggcgcggtggcgttcgggatcattgcgctgctgccggtcgagctgattttgcaggtg
ggttcatcggccggtttcgcgatgatcttcgccctgttgatcgccgcgatcctgtggaac
ctcggcacctggtggctgggtttgccggcgtcgtcgtcccacaccctgatcggctcgatc
atcggcgtgggcgtggcgaatgccttgatgcacgggcgtgacggcaccagcggcgtggac
tggagccaggcgatcaaaatcggttacgccttgctgctgtcgccgctgatcggcttcgcg
tttgcggccatgctgttactggccctgcgcgccttcgtcaaaaaccgtgcgctgtacaag
gcgccgaaaggcgacaccccgccgccatggtggatccgcggcatgctgatcgccacctgc
accggcgtgtccttcgcccacggttccaacgatgggcaaaaaggcatgggcctgatcatg
ctgatcctggtcggcaccctgccgatggcctacgcgctgaaccgcaccatgccggccgag
cagtcgttgcagttcgcggccgtggccgaagtcacccaggttgccctggtgaaaagcgca
ccgcaaccgctgagcggcgatccgcgcccgattctctcgacctacgtacgcaccaaggaa
gccactgcagaactggtgccggccctcgcggccctggccgggcagatcggtgaggaggtc
aaaggctacggctccctggccaaagtgcctgccgaagccgtcggcaacgtgcgtaacgac
atgtacctgagcagcgaaaccattcgcctgatggacaagggcaaggtcggcaatttcgac
gccgatacccaaggcaagctgcaactgttcaagcaacaaatcgacaattccacgcgcttc
attccgctgtgggtcaagatcgccgtggcaatcgccctgggcctcggcaccatggtgggc
tggaagcgcatcgtggtgaccgtgggtgaaaagatcggcaagacccacctgacttacgcc
caaggcgcctcggctgaaatggtggcaatgctgaccatcggcgcggcggatatgtatggg
ttgccggtgtcgacgacgcatgtgttgtcgtcgggcgtcgcggggacgatggtggctaat
ggcggtgggttgcagatgcgtacgatccgtaacctggcgatggcgtgggtactcacgttg
ccggcggcgatcctgctttccggcagcctttactggctgttcacccaactcttctga

DBGET integrated database retrieval system