KEGG   Pseudomonas fluorescens SBW25: PFLU_5198Help
Entry
PFLU_5198         CDS       T00899                                 

Definition
(GenBank) putative dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00380  Tryptophan metabolism
pfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    PFLU_5198
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     PFLU_5198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: CAY52266
UniProt: C3K206
Position
complement(5695062..5695919)
Genome map
AA seq 285 aa AA seqDB search
MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT
SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKAIR
PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI
KAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPNRYWDLYQLAEKFIDLEDSFRQWR
FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatgtcctttctctgctgattaccagccgcccgaagaatggcataacgccgaa
ctgaatttttccgagtccatgagctacggcgattacctggacctgggcaaagtcctcagc
gcccagcacccgctgtcgccggaccacaacgaaatgctcttcatcatccagcaccagact
tccgagttgtggatgaaactgatgctccacgaactcaaagctgcccgcgagcacgtacga
ctgggcgagttgccgccggcgttcaagatgctggcgcgggtgtcgcggatcttcgatcaa
ctggtgcacgcctgggcggtgctggcgacgatgacgccgtcggagtacaaggccatccgc
ccgttcctggggcagtcgtcggggttccagtcgttccagtaccgcgagatcgaatttatc
ctcggcaataaaagtgcggcgctgttgcggcctcacgcccaccggccggagctgttgaac
gagctgaaagtggcgattgccacgccgtcgctgtatgacgaggcgatcaacctgatgatc
aaggcgggcctggcgattgatcccaagcgtgccgagcgtgacccgacggctgcgacggtt
cacgatgaatccgtggaggcggcgtggcgggaggtgtatcgcgacccgaaccgttactgg
gatttgtatcagttggccgagaagtttatcgacctggaggattcgttccgccagtggcgc
tttcgccatgtgaccacggtggagcggatcattggcttccagccaggaaccggtggtacc
gaaggcgtggggtatttgcgcaagatgctcgataccgtgctcttccccgagctatggcga
gtacgctccacgctctaa

DBGET integrated database retrieval system