KEGG   Pelosinus fermentans: JBW_00072Help
Entry
JBW_00072         CDS       T03813                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pft  Pelosinus fermentans
Pathway
pft00071  Fatty acid degradation
pft00072  Synthesis and degradation of ketone bodies
pft00280  Valine, leucine and isoleucine degradation
pft00310  Lysine degradation
pft00362  Benzoate degradation
pft00380  Tryptophan metabolism
pft00620  Pyruvate metabolism
pft00630  Glyoxylate and dicarboxylate metabolism
pft00640  Propanoate metabolism
pft00650  Butanoate metabolism
pft00900  Terpenoid backbone biosynthesis
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01120  Microbial metabolism in diverse environments
pft01130  Biosynthesis of antibiotics
pft01200  Carbon metabolism
pft01212  Fatty acid metabolism
pft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JBW_00072
   00630 Glyoxylate and dicarboxylate metabolism
    JBW_00072
   00640 Propanoate metabolism
    JBW_00072
   00650 Butanoate metabolism
    JBW_00072
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JBW_00072
   00072 Synthesis and degradation of ketone bodies
    JBW_00072
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JBW_00072
   00310 Lysine degradation
    JBW_00072
   00380 Tryptophan metabolism
    JBW_00072
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JBW_00072
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JBW_00072
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JBW_00072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pft04147]
    JBW_00072
Enzymes [BR:pft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JBW_00072
Exosome [BR:pft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JBW_00072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AJQ25424
UniProt: I9NK82
Position
132740..133921
Genome map
AA seq 393 aa AA seqDB search
MREVVIASAVRTAIGSFNGVLAPFSASELGAAVIKEAVSRAGIKPENIEEVIFGNSVQAG
QGPNPARQSAIKAGLPVEVTSFTVNKLCGSGLKCVNLAAQAIMTGDADIIVAGGMESMTN
APYLLENRSRWGYRMGHGQVLDSLLQDALLCAFNNYHMGVTAENVAERYGITREEQDQMA
VESQKKAAAAIKSGAFKKELLPLVIKTKKGEVIVDTDEFPRAETTIEGLAKLKPAFKKDG
TVTAGNASGVNDGAAALVMMSAEKAKELGIKPMARIRSYASGGVDPSVMGLGPISATRKA
LTKAGLSINDMDLIEANEAFAAQFLAVGKELGFAKEKVNIHGGAVALGHPLGASGARILV
TLLHAMEKRNAKLGLATLCIGGGQGVATIVERM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagtagttattgcaagtgcagtacgtactgcaattggtagttttaacggtgtg
ctggcgcctttttctgctagtgaattgggagcagcagtaataaaagaagctgtatcccgt
gccggcataaaaccagaaaatattgaagaagtaatcttcggaaattcagtgcaggccggt
caaggaccaaatccggctcgtcagtcagccatcaaggcaggcttaccagtagaagtaacg
tcttttactgttaacaaattgtgtggttcaggtctgaaatgtgttaatcttgcagcgcag
gcaattatgactggagatgctgatattattgttgcaggcggtatggaaagtatgacgaat
gcaccttatcttctggaaaacaggtctaggtggggttatcgtatggggcatggtcaagtt
cttgatagtctgctacaggatgctttgttgtgtgcatttaataactatcatatgggcgta
actgctgaaaatgttgctgagagatatggaattactcgtgaagaacaagatcagatggct
gttgaatcacagaaaaaagctgctgcagcaattaaaagtggtgctttcaaaaaagaactt
ttgccgcttgttataaaaactaaaaaaggtgaagtaattgttgatactgatgaatttcct
cgtgcagaaactaccatagaaggattagccaagctaaagcctgcattcaagaaagacggg
actgttactgctggtaacgcttcaggagttaatgatggtgctgcagctttagtaatgatg
tcagccgaaaaagccaaagaacttggcattaaaccaatggctcgtattcgttcttatgct
tctggaggggttgatccaagtgttatgggcttgggacctatatctgctactcgtaaggca
ttgactaaagctggtcttagtatcaatgatatggatttaattgaagctaatgaagcattt
gctgcacagtttctggcagtcggtaaggaacttgggtttgccaaggaaaaagtaaatatc
catgggggggcagttgctcttggacatccgttaggcgctagcggtgcacgtattctggta
acactgctgcacgccatggagaaaagaaatgctaagcttggtctggctactttgtgtata
ggtggcggtcaaggtgtagcaactattgttgaaagaatgtaa

DBGET integrated database retrieval system