KEGG   Pelosinus fermentans: JBW_00492Help
Entry
JBW_00492         CDS       T03813                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pft  Pelosinus fermentans
Pathway
pft00450  Selenocompound metabolism
pft00970  Aminoacyl-tRNA biosynthesis
pft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    JBW_00492
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JBW_00492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pft01007]
    JBW_00492
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pft03016]
    JBW_00492
Enzymes [BR:pft01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     JBW_00492
Amino acid related enzymes [BR:pft01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   JBW_00492
Transfer RNA biogenesis [BR:pft03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    JBW_00492
 Prokaryotic type
   Other AARSs
    JBW_00492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f PDDEXK_1 Rad33
Motif
Other DBs
NCBI-ProteinID: AJQ25844
UniProt: I8TRF1
Position
635982..637916
Genome map
AA seq 644 aa AA seqDB search
MEKKPFYITTPIYYPSDRLHIGHAYTTTIADAAARYKRLAGSEVLFLTGSDEHGQKIQRK
AAEQNVTPIAYVDKIVDSFQQLWEKLNISHDDFIRTTQQRHHDVVQAIFQKIYDKGDIYK
AAYEGWYCTPCETFWMERQVVEGKCPDCGRPVEIVQEESYFFRMSKYQDRLLAYIESNPD
FIQPVSRRNEMLNFIKGGLEDLCVSRTTFDWGIPVPFDTKHVVYVWFDALTNYITAAGYL
DDREKFAKFWPADIHLVGKEIVRFHSIIWPIILMALDLEIPAKVYGHGWLIMEGDKMSKS
KGNVIDPVTLIEEFGPDAIRYFLLREINLGMDGNFSREALINRINADLANDLGNLLHRTL
NMIGRFNGGVIKAAGDVEELDHQLAQLVQSTVIQYEKFMDVMDINAAIKVVWALISRTNK
YIDETAPWALAKDEAKHSRLNTVLYNLAETLRIIAILITPFMPVTGPKIWGQLGLTTDFK
AVTLEDVKGWGKLPAGIVVSKPEPIFPRIEDKVVEAAAEVKAADQDKQQSAAVADENTPE
VSIDEFAKMDLRVVTVLAAEKVEKADKLLKLTVDLGTQQRTIVSGIAKHYTPEELVGQNV
VMIINLKPAKIRGIESRGMVLAASCDDQLKVVTVPGMPAGSKVK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagaaaccattttatattacaacgcctatttattatccgagtgatcgcttacat
attggtcatgcttacacaacgaccattgctgatgcggctgccaggtataaaaggctagcg
ggatcagaagtactctttctcactggatcagatgaacatggtcaaaaaattcagcgcaaa
gcggcagaacagaatgtgacaccgattgcttatgttgataaaattgttgattcttttcag
caattatgggagaaattgaatatttctcatgatgattttattcgtacaacgcagcagcgt
caccatgatgttgtgcaagctattttccagaaaatttatgataaaggtgatatttacaaa
gctgcttatgaaggctggtattgtactccttgcgaaaccttctggatggagcggcaggtt
gtagaggggaagtgtcctgactgcgggcggccagtagaaatcgtgcaggaggaaagttat
ttcttccgcatgtctaaatatcaagaccgattgcttgcctatattgaaagcaatcctgat
ttcattcagcctgtatctcgccgtaatgaaatgctgaattttattaagggggggttagag
gatctttgtgtttcccgcacaacctttgactgggggattcctgtaccctttgacaccaag
catgtcgtgtatgtatggtttgacgccttaaccaattatattaccgctgcaggctatcta
gatgatcgggagaaatttgctaagttctggccagctgacattcatttagtcggaaaggaa
attgtacgttttcatagtattatttggccgattatcttaatggctttggatcttgaaata
ccggcaaaggtatatggacacggctggttaatcatggaaggcgataaaatgtccaaatcc
aaaggcaatgtaattgatccggttaccttaattgaagagtttggtccagatgcaattcgt
tatttcttgctgagagagatcaatttaggaatggatgggaatttctccagagaagctctt
attaatcggattaatgctgatttggcaaatgacttaggaaacttattgcatagaacgtta
aacatgattggtcgttttaatggtggtgtgattaaagcagctggtgatgtagaagaacta
gatcaccagttggcacaattagtacagagtaccgttatccaatatgaaaaatttatggat
gttatggatattaatgcagcaatcaaagttgtttgggcattgatcagccgtaccaataaa
tatattgatgaaacggctccctgggcattagctaaggatgaggcgaagcactcccgcctt
aatacggtgctgtacaatctggcagagacgctgcgaattatagcaattttgattactcct
tttatgccggttacaggaccaaagatttgggggcagttggggttaaccactgattttaaa
gctgtaaccttggaggatgttaagggctggggaaaactacccgcaggcattgttgtatcg
aaacctgaacctatcttcccacggattgaagataaggttgttgaagctgcagcagaagtg
aaggcggcagatcaggataaacaacagtcagcagcggtagctgatgaaaatacccctgag
gttagcattgatgaatttgcaaagatggatcttagagtcgtcaccgtactagcagctgaa
aaagtggaaaaggctgataagctcttgaaattgacggtggacttgggcacccagcagcgt
actattgtttcaggcattgctaagcattacacaccagaagaattagtaggtcagaatgta
gtcatgattattaacttaaagccagcgaaaattcgcggtatcgaatctcgtggcatggtt
ttagcggcttcttgtgatgatcaattaaaagtagtcaccgttcccggaatgcctgccggc
agcaaggtgaaataa

DBGET integrated database retrieval system