KEGG   Pelosinus fermentans: JBW_01655
Entry
JBW_01655         CDS       T03813                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pft  Pelosinus fermentans
Pathway
pft00472  D-Arginine and D-ornithine metabolism
pft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    JBW_01655
Enzymes [BR:pft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     JBW_01655
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067 Integrase_Zn DUF3173
Other DBs
NCBI-ProteinID: AJQ27005
UniProt: I9DMW4
Position
1941472..1941837
AA seq 121 aa
MQRNDDYLQRRVHLAPLTDEELKDRFWELAKQLVEPLVELADTHTSPSVERSVLLRMGFS
SMEAKEIVQHCEEQGLLGKGAGHAVWRLAALKKIDYREAGLQLGKGQGWEKLAQFWAKGG
A
NT seq 366 nt   +upstreamnt  +downstreamnt
atgcagagaaatgatgattatttacagcgaagagttcatctagcacctttgacggatgaa
gaattaaaggatcgtttttgggaattggcaaaacaactagttgagccgctggttgaactg
gcagatacacatacttcgccgtcggtggagcgttcggtattgttacgcatgggattttct
agtatggaagccaaagaaattgttcagcattgtgaggaacaaggacttctgggcaagggg
gctggtcatgctgtatggcggctagctgcattaaaaaagatagactatcgtgaagctggc
ttgcagttaggtaaaggtcaaggttgggagaaattagcgcagttttgggcaaagggggga
gcctaa

DBGET integrated database retrieval system