KEGG   Pelosinus fermentans: JBW_01656
Entry
JBW_01656         CDS       T03813                                 

Definition
(GenBank) D-Lysine 56-aminomutase alpha subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
pft  Pelosinus fermentans
Pathway
pft00472  D-Arginine and D-ornithine metabolism
pft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    JBW_01656
Enzymes [BR:pft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     JBW_01656
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AJQ27006
UniProt: I8U1U3
Position
1941837..1944038
AA seq 733 aa
MILNHEDKISLEAILTDLQTYRPKRKGWTWRKPHATGKIGPFTYKQTSESLQASGGLPAS
KYFNSIDPQPDCVITTEIASGRFEDDIRRMRMAAWHGADHLMVIRTAGQSHFDGLIEGTP
EGVGGVPITRKQLRATRKALDYIEEEVGRPINFHSYVSGVAGPEVAVLFSEEGVNGAHQD
PQYNVLYRNINMYRSFVDAAVAKKMMATSGMAQIDGAHNANATAREAWKVMPELMVQHAI
NCQYSVMVGMLKDKICLSTVPPTAPPAPCISLDLPYAVALRQLFKGYRFRAQMNTKYMES
CTREVTTTHVLNTLLSRLTSADIQSTITPDEGRNVPWHYNNIHGVNTAKQALLGLDGIMD
YVTLNFDGPLGEKVRELKERACLFMEEIVASGGYFTAVSQGFFVDSGFYPERGGDGIARQ
MNGGVGAGTIVPRDKDYMAPVCDHFGYNKLPADCSVTEPCDLIDGCTLCHSEKIQWIDEL
DPEDNVYKRLAQNETERKEGLLRPEVQWHGDGIVCMTMFLPAAERVAEFAAKDIAERLGL
EDVEVIHKQAMHPSEGALIEVKGKVPFGIDPAKLVIPPLVEPLSEEAIRQYVSENKLKIV
AATVGEDEHSVGLKEILDIKHGGIEKFGIECNYLGTSVSVEKLADAAVEIGADAILASAI
ISHSDIHRINMRRLHQYCQEKGIRQDLIVVCGGTQITNEMAKEEGMDAGFGRGTKGVHVA
SFLVDQHRANKKG
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgatattgaatcatgaagataagatttcgttggaagcaatattaacagatctacagaca
tatcgtcccaaacgcaaaggctggacgtggcgcaaaccccatgcaactgggaaaatcggt
ccttttacctataagcagacatcggaatcccttcaagcgtctggaggattacccgcatcc
aaatatttcaatagtattgatccccagcctgattgtgttattactactgaaatagcctca
ggacgatttgaggacgatattcgccggatgcgtatggcagcttggcacggtgcggatcat
cttatggttattcgtacggcaggacaaagccactttgatggcttaattgaaggcactcct
gaaggtgtgggcggtgtgccgattacgcgcaaacaacttcgcgcaacccgcaaagcacta
gactatattgaagaggaagtcggtcgcccgattaattttcactcttatgtaagtggtgta
gcaggcccagaagttgccgtgttgttttctgaagaaggagtaaatggagcgcaccaagac
ccacaatataatgtattgtaccgcaatatcaatatgtaccgttcctttgttgatgctgct
gttgccaagaaaatgatggcaacaagtggtatggcccaaattgatggtgcacacaatgct
aatgctacggcgcgtgaagcgtggaaagtaatgccagaattgatggtgcagcatgctatc
aattgtcaatattctgtaatggtagggatgctcaaggacaagatttgtttgtctaccgtg
ccgccaactgcgccgccagctccgtgtattagcttggatctgccctatgctgtagcattg
cgccaactgttcaagggttatagatttcgcgcacaaatgaatactaagtatatggaatcc
tgcacacgggaagttacaactacccatgtgctgaatacgttgctgtcaagattgaccagt
gccgatattcaaagcacgattacaccagatgagggccgcaatgttccttggcattataat
aacattcatggtgtaaataccgcgaaacaagcgctgcttgggctagatggtattatggat
tacgtcactctcaattttgacggacctctgggtgaaaaagttcgtgaattaaaagaacga
gcttgtttattcatggaagaaattgtggcatccggcggttactttacggcagtcagccaa
gggttcttcgtagattcaggtttctatccagaacgaggtggagatggtattgcgaggcaa
atgaatggcggcgttggagcaggcaccatagttccccgggataaagactatatggcaccg
gtttgtgatcactttggttataataagttgccagcagattgtagtgttaccgaaccatgt
gatttgattgacggttgtaccttatgccattcagaaaaaatccagtggattgatgaactg
gatccagaagataatgtatataagcggttggctcagaatgaaacagaacgtaaagaaggg
ttattacggccagaagtacagtggcatggtgacggtatcgtttgtatgaccatgttcttg
ccggcagcagaacgtgtggcagaatttgctgcaaaggatattgcggaacgattgggatta
gaagatgttgaagttattcacaaacaagccatgcatccttcagagggagcactaattgaa
gtaaaaggtaaggtaccattcggtatcgatccggcaaaattagtgattccgcctttagtt
gaacctctaagtgaagaggcaatcaggcaatacgttagtgagaataagttgaaaatcgtg
gcagccacagtaggggaagatgagcattctgttggtctaaaggaaatccttgatattaag
catggtgggattgagaaatttggcatcgaatgtaattatctgggaacatccgtatcggta
gaaaaactagcagatgcggcggtggaaattggcgcagacgcgattttggctagtgcaatt
atctcccattctgatattcatcgcatcaacatgcggcgactacatcaatattgccaggaa
aaaggcattcgacaagatctgatcgttgtttgtggtggaacacaaattacgaatgaaatg
gccaaggaagaaggcatggatgctggctttggtcgtggtacgaaaggcgttcatgtagct
agctttttagtcgatcagcatcgcgcaaacaagaaagggtga

DBGET integrated database retrieval system