KEGG   Pelosinus fermentans: JBW_01782Help
Entry
JBW_01782         CDS       T03813                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pft  Pelosinus fermentans
Pathway
pft00020  Citrate cycle (TCA cycle)
pft00480  Glutathione metabolism
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01120  Microbial metabolism in diverse environments
pft01130  Biosynthesis of antibiotics
pft01200  Carbon metabolism
pft01210  2-Oxocarboxylic acid metabolism
pft01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JBW_01782
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JBW_01782
Enzymes [BR:pft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     JBW_01782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Dak1 RTBV_P12 Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AJQ27132
UniProt: I9NJI0
Position
2081614..2082825
Genome map
AA seq 403 aa AA seqDB search
MTKKIKMITPLVEMDGDEMTRIIWKMIKDILLTPYIDLKTEYYDLGLEYRDKTNDKVTEE
SAIAIKKYGVGVKCATITPNADRVKEYKLKQMWKSPNGTIRSILDGTVFRTPLIVDSIKP
FVKPWTKPITIARHAYGDIYKNVEHRVTGKGKAELVFTSESGEVTSKVIHEFKGAGVLMG
IHNLDASIENFARACFNYALDQKQDLWFSAKDTISKTYDHTFKDIFQEIFDKDFKEKFAA
AKIEYFYTLIDDVVARIMRSEGGIIWACKNYDGDVMSDMVASAFGSLAMMTSVLVSPDGD
YEYEAAHGTVQRHYYKHLKGEETSTNSMATLFAWTGALKKRGELDGINELVDFAAKLEKA
AIQTIEEGVITKDLAELSEVKEKKVVNTENFLKEVNIRLAAIL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaatcaaaatgattacccccttagtagaaatggatggggatgaaatgact
aggattatctggaaaatgataaaagacattctgttgactccatatattgatttgaaaaca
gaatattatgatctgggtcttgagtacagagataaaacgaacgataaggtaaccgaagaa
tcagcaatagctataaaaaaatatggagttggcgttaagtgcgcaaccattactccaaat
gcagaccgcgtgaaagaatataaattgaaacagatgtggaaaagtccaaatggtacaatt
cgttcgattctagatggaaccgtttttagaactcctctcattgttgatagtattaaacct
tttgtgaaaccatggactaaaccgattacgattgccagacatgcttatggtgatatctat
aaaaatgttgaacatcgggttactggcaagggaaaagcggaacttgtcttcactagtgaa
tctggtgaagttacctcaaaagtgatccatgagtttaaaggggctggtgtacttatgggg
attcacaatcttgatgcctcaatagaaaactttgcaagagcttgcttcaattatgcttta
gatcaaaaacaagatctgtggttttcagccaaagatacaatttccaaaacatatgatcat
accttcaaagatatttttcaagaaatttttgataaagactttaaagaaaaatttgcagca
gcaaaaattgagtatttttatacactgattgatgatgttgttgctagaattatgcgttct
gaaggtggaattatttgggcatgcaaaaattatgatggtgatgtaatgtcagatatggtt
gcaagtgcatttggcagcttggcaatgatgacttctgttcttgtatctccagatggtgat
tacgaatatgaagcggctcacggtacagtacaaagacattactacaaacatctcaaaggg
gaagaaacatccaccaactcaatggctacactctttgcatggacaggagccttgaaaaaa
cgcggagaacttgatggaatcaatgagttagttgattttgctgctaaactggaaaaagct
gcaattcaaacaatcgaagaaggcgtaatcacaaaagatttagcagagctttctgaagtc
aaggagaaaaaagttgttaataccgaaaatttcttgaaagaagtaaatatacgtcttgca
gcaatattatag

DBGET integrated database retrieval system