KEGG   Pelosinus fermentans: JBW_02024Help
Entry
JBW_02024         CDS       T03813                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
pft  Pelosinus fermentans
Pathway
pft00471  D-Glutamine and D-glutamate metabolism
pft00550  Peptidoglycan biosynthesis
pft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    JBW_02024
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JBW_02024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pft01011]
    JBW_02024
Enzymes [BR:pft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     JBW_02024
Peptidoglycan biosynthesis and degradation proteins [BR:pft01011]
 Precursor biosynthesis
  Amino acid ligase
   JBW_02024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_2 Pyr_redox NAD_binding_8 AlaDh_PNT_C DAO Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJQ27374
UniProt: I8U0A9
Position
2329851..2331206
Genome map
AA seq 451 aa AA seqDB search
MHFKGTKILVLGAGISGISVACVLQNRGAQITLSDSKSAELLKNKDFSPIHQCGVTLALG
QQGEELLQDIDYIVLSPGISIEIPLVKIAKAKNIKVMSEIEVAYQLCTAPIVAITGTNGK
TTTTTLIGEMVKTTDRNVVVGGNIGLALSQEVAEVGENGIVVAEISSFQLEGIIDFRPRV
AAILNITPDHLDRHHSLENYIAMKERIFANQTKDDYIVLNYDDITVREMANKVPSKVFFF
SRKVELDSGIFVKDGMIIIKWQEKTYIVCPISKIQLRGGHNIENVLAACGVAFFAGVTLI
SMVQTLFNFTGVEHRIEKVTVVNGVPYYNDSKATNPESSIKALEAFEQPIILIAGGRDKN
TDLTAFMKLIKEKVEHLILLGEAQERFEAAAIKHDVSQIHNVNSLSEAVQLAYHLAKEPQ
VVLLSPACASYDMFTSYEERGKVFKRLVYEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcattttaagggaacaaagatcttagtacttggtgctggtatcagcggtatctctgtt
gcctgtgttttacaaaaccgtggagcacagataacattaagtgattctaaatcagcggaa
ttattaaagaataaggatttctcgcccatacatcaatgtggagtaaccctggcgttaggt
caacagggagaggaattgcttcaggatatagactatatcgtactgtctcctgggatatca
attgaaattccattagtaaaaatagctaaagctaaaaatattaaagtcatgagtgaaatt
gaagtagcatatcaattgtgtacagcacctattgtggccattacaggtacaaatggtaag
acgacaacgacaacattgattggtgaaatggtaaaaacaacagatcgcaatgtagttgta
ggaggaaatattggtttagccttgtcacaagaagtggctgaagtgggtgaaaacggtata
gttgtagctgaaatatccagctttcaattagaaggcattattgattttaggcctcgtgtg
gctgctattttaaatataactcctgatcatctggatcgacatcattcgctagagaattat
attgcgatgaaagaacgtatttttgcaaatcaaacaaaagatgattatatcgttctaaat
tatgatgatataactgtacgagaaatggcgaacaaagttccttctaaagttttctttttt
agcaggaaggtagaattagattcaggaatatttgtaaaagatggaatgatcattattaag
tggcaagaaaaaacatatattgtatgtccaattagtaaaatacaacttagaggtggacat
aatattgaaaatgttctcgccgcttgtggtgttgccttctttgcaggtgttactttaatt
tctatggtgcagaccttattcaattttacaggtgttgagcaccgaattgaaaaagtaaca
gtggtcaacggtgtgccttactataatgactcgaaagcaacgaatcctgagtcatcaatt
aaagccttagaggcttttgaacaacctatcatattaattgcaggcggacgagataaaaat
acagatttaactgcttttatgaaattgatcaaagaaaaggtggagcatttaattttatta
ggtgaggctcaagagagatttgaagcagcggcaattaagcatgatgtatcgcaaattcat
aatgtaaatagtttgtctgaagctgtacaattagcatatcaccttgcaaaggaaccgcaa
gtcgtgttattatctccggcatgtgctagttatgacatgtttacgagttatgaagaaaga
ggaaaagtattcaaaagattagtttatgaattataa

DBGET integrated database retrieval system