KEGG   Pelosinus fermentans: JBW_02839Help
Entry
JBW_02839         CDS       T03813                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pft  Pelosinus fermentans
Brite
KEGG Orthology (KO) [BR:pft00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    JBW_02839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJQ28183
UniProt: I8TZY0
Position
complement(3186302..3187291)
Genome map
AA seq 329 aa AA seqDB search
MPDTLIIFVVLLALAFDYINGFHDTANAIATSVSTRALTPRVAVWMAAMLNFLGAMYSTG
VAKTIGSDLVKSAQMVNQHIIIAAIIGAIFWNLLTWWKGIPSSSSHALVGGVVGAVLVST
GYEALKIEGILKIVAALICSPVIAMITGFAVMTVLLWIFGRKAPSRINPKFKKAQILTAA
MMAFSHGSNDAQKAMGIITLTLVSTGYLTSLDVPIWVKLSAATAMGLGTAAGGWRIIRTM
GSKIFKLEPISGFASDLNSSLIIFGATLLHLPVSTTHVVSGSIMGVGTSKRISAVHWGVA
QQMLMAWVLTIPCTALVSALAYKVMSFFF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatacattgatcatttttgttgttttattagcattagcctttgactatattaat
ggatttcatgatactgctaatgcaatagccacatcggtttctacacgagcattaacacca
cgggttgcagtatggatggctgctatgcttaactttctcggtgctatgtatagtacaggc
gttgctaagacaattggcagcgatctggtaaaatcagcgcagatggtgaatcagcacatt
attattgcggcgatcatcggtgcaattttctggaatttgctaacttggtggaaagggatt
cctagtagttcctctcatgctttagtaggcggagtcgttggtgcagtattagtttctaca
ggctatgaggcacttaaaatagaaggcattttgaaaattgttgctgccttaatctgttct
ccagtcattgccatgattacaggatttgccgttatgacagttctgttgtggatatttggc
agaaaagctccatcgcgtattaatcctaaatttaaaaaggcacaaattttgacagcagcc
atgatggctttttcccatggatcaaatgatgcgcaaaaggctatggggattattactttg
accttagtgagtacaggctatttaaccagcttagatgttcctatctgggttaagttatca
gcagctacggctatgggattaggtacggcagcaggtggttggagaattattcgtaccatg
ggtagtaagatttttaaattggagccgattagtggctttgcctcggatttgaattcttca
ttgattatttttggcgcaacattattgcatttgccagtaagtacaacacatgtggtttca
gggtctatcatgggggtaggaacttcaaaacgcattagtgcagttcactggggtgtagcg
cagcaaatgctcatggcgtgggtattaacaattccttgcacagctttagtaagtgccttg
gcttataaagtcatgtctttctttttttag

DBGET integrated database retrieval system