KEGG   Pelosinus fermentans: JBW_03081Help
Entry
JBW_03081         CDS       T03813                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pft  Pelosinus fermentans
Pathway
pft00260  Glycine, serine and threonine metabolism
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01120  Microbial metabolism in diverse environments
pft01130  Biosynthesis of antibiotics
pft01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JBW_03081
Enzymes [BR:pft01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     JBW_03081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJQ28422
UniProt: I8TYW0
Position
complement(3428026..3429060)
Genome map
AA seq 344 aa AA seqDB search
MIRFESDYTEGAHERIMKRLLETNEEQTPGYGMDEHCEKARACIRKACHAENADVHFLVG
GTQTNTTIIASILRPHQGAVAAITGHITVHETGAIEATGHKVLTLPSDDGKIQAEQVKDL
YDAHWNDVNHEHMVQPGLVYISHPTENGTTYSRSELEALSKVCRECGLPLVMDGARLGYG
LAAKGSDLSLADIAKLCDVFYIGGTKVGAMFGEAVVIINNALKKDFRYFIKQNGGMLAKG
RLLGVQFETLFEDGLYYEISKHAVDMAIMIREAFAKKGFSFRYDSTTNQQFPILPDDVLM
ELSEKYSYSFWEKVDAAHSAVRFCTSWATNKKNVEMLTKDIEAL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatacgatttgaaagtgattatacagaaggtgctcatgagcgaattatgaaacgatta
ttggaaaccaatgaagagcagacacccggttatggtatggatgaacactgtgaaaaagct
agagcttgtattagaaaagcgtgtcatgcagagaatgcagatgtacactttttagttgga
ggaacacagacgaatactactattatcgcttccattttgcgcccgcatcaaggcgcagtt
gctgcaattactggacatatcacagtacatgaaactggggcgattgaagctactggtcat
aaagtacttactttgccgagtgatgatgggaaaatccaggcagaacaggtaaaagattta
tatgatgctcactggaatgatgtcaatcatgagcatatggtacagcccggattggtttac
atttctcaccctaccgagaatggaaccacttatagtagatccgaattggaagctttaagt
aaagtttgccgggaatgtggtttaccgctggttatggatggcgccagattaggatatggt
ctggctgccaaaggcagtgatttatctttggcagatattgcaaagctatgtgatgtattt
tatataggaggaacgaaagttggagcaatgtttggtgaggcagtagtaattataaataat
gctttgaaaaaagattttcggtattttatcaagcaaaatggaggaatgctggctaagggg
agattattgggtgttcagtttgaaaccttatttgaagatggcttatattatgaaatttct
aagcacgccgtggatatggcgattatgattcgagaggcatttgctaaaaaaggattttct
tttcgatatgattctacaacaaatcagcagtttccaattttgccggatgatgtcttaatg
gaattaagcgaaaagtattcttattccttctgggaaaaggtcgatgctgcacacagtgct
gtaaggttttgtaccagctgggctacgaataagaaaaatgttgaaatgctgacaaaggat
attgaggcattataa

DBGET integrated database retrieval system