KEGG   Pelosinus fermentans: JBW_03499Help
Entry
JBW_03499         CDS       T03813                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pft  Pelosinus fermentans
Pathway
pft00030  Pentose phosphate pathway
pft00480  Glutathione metabolism
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01120  Microbial metabolism in diverse environments
pft01200  Carbon metabolism
Module
pft_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pft_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JBW_03499
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JBW_03499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pft04147]
    JBW_03499
Enzymes [BR:pft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     JBW_03499
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     JBW_03499
Exosome [BR:pft04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   JBW_03499
  Exosomal proteins of colorectal cancer cells
   JBW_03499
  Exosomal proteins of bladder cancer cells
   JBW_03499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N EHD_N
Motif
Other DBs
NCBI-ProteinID: AJQ28838
UniProt: I9NSL4
Position
complement(3899303..3900820)
Genome map
AA seq 505 aa AA seqDB search
MMLDVKIEPTVIVIFGASGDLTQRKIIPAIYNLFIDGLLPDPFCIIGIARTASDDEMFRQ
QLRKGVDAFSRRGRSKEDDWSKFAANISYMAADYHDEKTYRFLLEELKKGWYKSANKVLY
LATPPTLFTEIVEQLGQQEVFRGKTSYRIVIEKPFGRDLESARMVNQVLTGVFDEGQIYR
IDHYLGKETVQNILAFRFANAMWEPIWNRSFIDHVQITVAEKVGVGKRGGYYEGAGALRD
MVQNHLLQVMCLVAMEPPTSFQADEVRNKRVDVLNAIRPIGKDEVEKFAVRGQYSKGVVD
GLPVPAYREEENVAAGSGRETFVAMKLFIDNWRWQGVPFYLRTGKHLPGRVSEISLQFRP
VPHHPFSDKVMQSNRLAIQIEPKEGIMLRTQAKEPGPGMKIKPVEMHYTYQEVFQSSSPE
AYETLLLDVVRGDPGLFMRNDQVETAWSVLESVLEHWEETSPADFPNYAPGEWGPKSAEE
LITQDGRTWLVPACLEFDRKEGRKT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgatgtgaaaattgagccaactgtaattgttatttttggtgcatctggggat
ttaacgcagcgtaagattatacctgctatctacaacttatttattgatggcttattgcct
gatcctttctgcattattggcattgcacgtactgcgtccgacgatgaaatgtttcgacag
caattgcgcaaaggtgtggatgcattttctcgcaggggtagaagcaaggaagatgattgg
tcaaaatttgcagctaatatatcctatatggcagctgattatcatgatgaaaaaacctat
aggtttcttttggaagagttaaaaaaaggctggtataagtctgctaataaggtattgtac
cttgcgactcctcctactttatttacagaaattgtggaacagttaggacagcaggaggtt
tttcgcggaaaaacaagctatcgcattgtcatagaaaagccttttggtagagacttggaa
tctgcccgaatggttaaccaggtgttaacaggtgtctttgatgaaggacagatctatcgc
atagaccattatttaggaaaagaaacggtacaaaatattttggcgtttcgttttgccaat
gctatgtgggaacctatttggaaccgcagctttattgaccatgttcagattacagtggca
gaaaaagtcggtgtcggcaagcgagggggctattatgagggggctggagccctgcgtgat
atggtccagaatcatctattacaggtaatgtgcctggtggcgatggagcctcctacttcc
tttcaggctgatgaagttcgtaacaagagagtggatgtactcaatgcgattcgtcctata
ggcaaagatgaggtagaaaaatttgctgttcggggtcaatatagcaagggagtggtagac
ggtcttccagtacctgcttatcgagaagaagaaaatgtagcggcaggttcaggtagagaa
acctttgtagcaatgaagttatttattgataattggcgttggcagggagtgcctttttat
ttgcgtacaggtaagcatttaccaggtcgtgtttctgaaatctccctgcagtttaggccg
gtaccacatcatcctttttctgataaggtcatgcagtccaatcgcctggcgattcaaatt
gagcctaaggaaggtattatgctgcggacacaggcaaaagagccgggaccggggatgaag
attaaacctgtggaaatgcattatacctatcaggaagtatttcagtcttcttctcccgaa
gcctatgaaacattgctgttagacgttgtgcgtggcgatcctgggctgtttatgagaaat
gatcaggtagaaacagcttggtctgtattagagtccgtattagaacattgggaagagact
tctcctgcagattttcctaattatgcaccgggtgagtggggacctaaatctgctgaagag
ttgattacccaagatggaagaacatggttggttcctgcctgcttagaattcgatagaaaa
gaaggaagaaaaacatga

DBGET integrated database retrieval system