KEGG   Pelosinus fermentans: JBW_04595Help
Entry
JBW_04595         CDS       T03813                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pft  Pelosinus fermentans
Pathway
pft00220  Arginine biosynthesis
pft00330  Arginine and proline metabolism
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01130  Biosynthesis of antibiotics
pft01230  Biosynthesis of amino acids
Module
pft_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    JBW_04595
   00330 Arginine and proline metabolism
    JBW_04595
Enzymes [BR:pft01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     JBW_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AJQ29924
UniProt: I9NUV6
Position
complement(5151077..5152033)
Genome map
AA seq 318 aa AA seqDB search
MNFMKRKISIVGVPMWLGQTRYGTNLGPQGIRCAGLMDRLKGIGQDVVDEGNLSIGITGC
FRQSGENIKNVKTLVDSSEKLAAKVSNIIQEGRFPLVLGGDHSIAMGTLAGIAKHYKNIG
VIWYDAHADMNTPETSPTGNIHGMPLAASMGLGHSALTNIGGYQGKVKPEHIVLIGARDV
DQGEQQLIEEKHIKMYTANDVKRLGMEVVIAEAVRYLSERCDGIHLSFDVDGIDPAEFPG
VGTPVANGLSYKESLQAVRLLAAAENLISAEFVEVNPLLDKDDMTARLTVNLIGALFGET
AKSKQVQRTDRKRSAEAI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttcatgaaaagaaagatttcgattgttggtgtaccaatgtggttgggacagact
cgctatggtaccaacttaggaccccagggtatccggtgtgcagggttaatggatcgtcta
aaaggtatcggacaggatgtcgtagatgaaggtaatctttctattggcattacaggatgc
tttagacaaagcggcgagaatattaaaaatgtaaaaacccttgttgattcaagtgaaaag
ttggcagcaaaggtttcaaatattatacaagaagggcgctttccccttgttttaggcgga
gaccacagcattgccatggggacattagctggtattgcaaaacattataagaatattggt
gtcatttggtacgatgctcatgctgatatgaatacgcctgaaacatccccgactggcaat
attcatggcatgcctttagcagccagtatgggattaggtcattcggctttgacgaatatt
ggaggctatcagggaaaagtgaaaccggagcatattgtgttgattggtgctcgggatgtg
gatcaaggggagcagcagcttattgaggaaaaacatataaaaatgtacactgccaatgat
gttaaacgactgggcatggaagtagtcatcgccgaggcagtacgttatttatcagaacgt
tgtgatggaatccatttaagctttgatgtagatggtattgatcctgcagaattcccggga
gtagggacccccgtcgccaatggccttagttataaagaaagtctgcaggccgtacggtta
ttagcggcagctgaaaatttgatttccgcggaatttgtagaggtcaatccattgctggat
aaagatgatatgacggctcgtcttactgttaacctgattggagcattatttggtgagact
gctaaaagcaaacaggtgcaaagaacagatcgaaaaagaagtgctgaagcgatatga

DBGET integrated database retrieval system