KEGG   Pyrococcus furiosus DSM 3638: PF0082Help
Entry
PF0082            CDS       T00075                                 

Definition
(GenBank) membrane protein
  KO
K15497  molybdate/tungstate transport system ATP-binding protein [EC:7.3.2.5 7.3.2.6]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PF0082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF0082
Enzymes [BR:pfu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     PF0082
    7.3.2.6  ABC-type tungstate transporter
     PF0082
Transporters [BR:pfu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter
    PF0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE TOBE_2 AAA_21 CysA_C_terminal SbcCD_C AAA_16 AAA_29 SMC_N OB_MalK Mg_chelatase AAA_30 T2SSE AAA_23 PIF1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAL80206
UniProt: Q8U4K3
Position
87301..88335
Genome map
AA seq 344 aa AA seqDB search
MLEVQGISKKWKDFHLKDISFSVMDGEYFIVLGPSGAGKTVLLEIIAGIIPPDGGKVLLD
GKDITLLPPEKRGIAYVPQNYALFPNMSVFDNIAFGLKVRRVPRSEIEKRVLEISEVLGI
RHLLHRKPRTLSGGEQQRVAVARALVIEPEIILLDEPFANLDVQIRSRLINEMKRWRREL
GFTAIHVTHSFEEALALGDRVGIMLNGKLVQVGEIREVFSRPNSEEVAKFLGFENIIEGI
ADGRVLHVGKLRIELPLEAKGRVRIGIRPEDILISTERIKTSARNVFKAKVEAIEDVGPL
VKLTLNVCDITLRAFITRSSLVELGIEEGKEVYASFKASAIHVF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagtgcaaggaatatcaaagaagtggaaagactttcatctaaaggatataagc
ttctcggtaatggatggagagtatttcatagtccttggccctagcggggctgggaagacg
gtgttgcttgagataatagccggtataattcctccagatgggggaaaagtgttgctcgat
gggaaggacataactctcctccctccagaaaagaggggaatagcctacgttccacagaac
tatgccctcttccccaacatgagcgtttttgacaatatagcctttggactcaaggtaaga
agggttcccaggagtgaaatagagaaaagagttttggagatatctgaggttctagggata
aggcatctcctccatagaaaaccacggacattgagtggaggagaacagcagagagttgct
gtagcaagagccttagtaattgagcctgagataatacttcttgatgagccgtttgcaaac
cttgacgttcaaataaggagtagattaattaatgaaatgaaacgatggagaagggaactg
ggctttactgccatccatgtaacgcactcatttgaagaggccttggctcttggggataga
gttggtataatgttgaatggtaagttagtccaggtgggagaaattagagaagtgttttca
aggccaaatagtgaagaagtagctaaatttttgggatttgaaaacattatcgaaggcatt
gctgatgggagagttctccacgtaggaaagcttagaatagagcttccccttgaggctaag
gggagggttaggataggaataaggcctgaagatatattgatttcaactgaaagaatcaaa
acatccgctagaaatgtattcaaagctaaggtggaggcgatagaagatgttggccctctt
gtcaaattaacccttaatgtttgtgacataactcttagggcgtttataacaagatcatct
ctagtggagcttgggatagaagagggaaaagaagtctatgcgagctttaaagcctctgca
atccatgttttctag

DBGET integrated database retrieval system