KEGG   Pyrococcus furiosus DSM 3638: PF0301Help
Entry
PF0301            CDS       T00075                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00860  Porphyrin and chlorophyll metabolism
pfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PF0301
Enzymes [BR:pfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PF0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Peptidase_S51 GATase GATase_5 TMEM131_like GT-D SNO
Motif
Other DBs
NCBI-ProteinID: AAL80425
UniProt: Q8U3Z8
Position
complement(316573..318024)
Genome map
AA seq 483 aa AA seqDB search
MGKALMIQGTMSGVGKSLIATALCRIFSDLGYDVVPFKSQNMSLNSAPSIEGGEISRAQY
LQAIACRKKPSIKFNPILLKPEGNMRSQVVFLGEPIGSVSARDYMLSKKIELFRKSMEVL
KSLMKRHDLVIIEGAGSPVEINLKDYDIANMRVAREVNAPVILVADIDRGGSFAQIVGTM
ELLSEEERNLVMGFVFNKFRGDPSLLYPGFKFLEKKYGKPVLGVVPYIDHRLPEEDSLAE
FPRAKGEVHIQIIKLPHISNFTDFEPLHWANGVDYVTKAEEIKGDIIIIPGSKNTVEDLI
WMRENGIEDAIIEAHREGSFIVGICGGFQMLGEKIIDNVESKRGEVKGIGLLPAKTIFAR
EKRTNHLKAEVLWEPARGMRVEGYEIRFGRSTTRRPFSVIKWVNGRRVEEFEGAVGERTF
GTYLHGIFHNFEFTEAFLNLIRREKGLEPIKIREWSIEDEINRFAKIVRESIDVDYIIEF
LGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagctttaatgattcaaggaacgatgtcgggagtaggaaaatccctaatagca
acggcgctctgccgcatattctcggacttgggctatgatgttgttccatttaaaagccaa
aacatgagcctaaactcagctcccagcatagaaggaggagaaataagcagggctcaatac
cttcaggccatagcgtgtagaaagaagccaagcataaagtttaacccaattctgctcaag
cccgaaggtaatatgagaagtcaagttgtattccttggggaacctattggaagtgtctct
gctagggactacatgctttcaaagaaaatagagttgtttagaaagtcaatggaggtcctg
aaaagtctcatgaagaggcatgacctagttataatagaaggagctggaagccccgtggaa
attaacctgaaggactatgacatagccaacatgagggttgcaagggaagtcaatgcccca
gttattttggttgcagacattgataggggaggaagctttgcccaaatagtgggaacaatg
gagttgttaagtgaagaggaaagaaacctcgtgatgggattcgtattcaataagttcaga
ggagatcccagcctactttatccaggtttcaaattcttggagaaaaagtatggaaagcca
gtcttaggggttgttccctacattgaccacaggcttccagaagaagattcactggccgag
tttcccagggcgaaaggggaagttcacattcagataataaaacttccccacataagcaac
tttacggactttgagcctttgcactgggccaatggagtcgactacgtgacgaaggccgag
gaaattaaaggtgacataataatcatcccagggagcaagaatactgtggaggatttgatt
tggatgagagagaatgggattgaggatgcaattattgaagcccaccgtgagggttctttc
atcgttggaatttgcggaggatttcaaatgctcggagagaaaattattgataacgtagag
tccaagcggggagaagtaaaaggaattggccttttaccagcaaagacaatctttgcaagg
gaaaagagaacaaatcatctgaaggccgaagttttatgggaaccagccagaggaatgaga
gttgaggggtacgaaattaggtttggaaggtcaaccacgagaaggccgttttcagtaatt
aagtgggtaaacggaagaagagtggaagagtttgaaggtgcggtaggagagagaaccttt
gggacttacctccacggaatattccacaactttgagtttacggaggcattcctaaatctg
ataaggagagagaaggggctcgaaccaataaaaattcgggagtggagcattgaggatgag
ataaatagatttgcaaagatcgttcgggagagcatagacgtagattacatcatcgaattc
ctcggactctaa

DBGET integrated database retrieval system