KEGG   Pyrococcus furiosus DSM 3638: PF0537Help
Entry
PF0537            CDS       T00075                                 

Definition
(GenBank) hypothetical protein
  KO
K07578  homologs of the eukaryotic argonaute protein
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    PF0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAZ_siRNAbind Piwi
Motif
Other DBs
NCBI-ProteinID: AAL80661
UniProt: Q8U3D2
Structure
PDB: 

Position
complement(553680..555992)
Genome map
AA seq 770 aa AA seqDB search
MKAKVVINLVKINKKIIPDKIYVYRLFNDPEEELQKEGYSIYRLAYENVGIVIDPENLII
ATTKELEYEGEFIPEGEISFSELRNDYQSKLVLRLLKENGIGEYELSKLLRKFRKPKTFG
DYKVIPSVEMSVIKHDEDFYLVIHIIHQIQSMKTLWELVNKDPKELEEFLMTHKENLMLK
DIASPLKTVYKPCFEEYTKKPKLDHNQEIVKYWYNYHIERYWNTPEAKLEFYRKFGQVDL
KQPAILAKFASKIKKNKNYKIYLLPQLVVPTYNAEQLESDVAKEILEYTKLMPEERKELL
ENILAEVDSDIIDKSLSEIEVEKIAQELENKIRVRDDKGNSVPISQLNVQKSQLLLWTNY
SRKYPVILPYEVPEKFRKIREIPMFIILDSGLLADIQNFATNEFRELVKSMYYSLAKKYN
SLAKKARSTNEIGLPFLDFRGKEKVITEDLNSDKGIIEVVEQVSSFMKGKELGLAFIAAR
NKLSSEKFEEIKRRLFNLNVISQVVNEDTLKNKRDKYDRNRLDLFVRHNLLFQVLSKLGV
KYYVLDYRFNYDYIIGIDVAPMKRSEGYIGGSAVMFDSQGYIRKIVPIKIGEQRGESVDM
NEFFKEMVDKFKEFNIKLDNKKILLLRDGRITNNEEEGLKYISEMFDIEVVTMDVIKNHP
VRAFANMKMYFNLGGAIYLIPHKLKQAKGTPIPIKLAKKRIIKNGKVEKQSITRQDVLDI
FILTRLNYGSISADMRLPAPVHYAHKFANAIRNEWKIKEEFLAEGFLYFV
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaagttgttattaatctggtaaagataaataaaaaaataattccagataaa
atatatgtatataggctctttaatgacccagaggaagaacttcaaaaagagggatattct
atttatcgccttgcatatgaaaacgttggtattgttattgatccagagaatctgattatt
gccaccacaaaagagcttgaatatgagggagaatttattcccgagggtgaaatatcattc
tcggaattgcgtaatgactatcagagtaaacttgtcttaagattgttgaaggagaatgga
ataggtgaatatgaattatcgaaacttcttaggaagtttagaaaaccaaaaacttttggg
gattataaggtcattccaagcgttgagatgagtgtgataaagcatgatgaagatttttat
ttagtaattcatataattcatcaaatacaatcaatgaaaacactgtgggagcttgtaaac
aaagaccctaaagagcttgaagagtttttaatgactcacaaggaaaatttaatgctgaag
gacattgcgtcaccacttaaaactgtttataagccttgctttgaagagtatactaaaaaa
ccaaaacttgatcataatcaagaaatagtaaagtactggtataattatcatattgaaaga
tattggaatactccagaagctaaattagagttttatagaaaatttggccaagttgattta
aaacaacctgcaattctagcgaaatttgcatctaaaataaagaaaaacaaaaattacaag
atatatctcttgccccaattagttgtcccaacttataacgccgaacaattagaaagtgac
gtggcgaaagaaattttagaatatacaaaactgatgccagaagaacgtaaagagctttta
gaaaacatccttgcagaagttgatagtgacattatagacaaatcattaagtgaaattgaa
gtagaaaaaattgcacaagaattggaaaacaaaataagggttagagatgacaaagggaac
agtgtaccaatttctcaattaaatgttcaaaaatctcaattactactttggacgaattat
tcacgaaaatatccagttatattgccttatgaagttccagaaaagttcagaaaaatacgg
gagataccaatgtttataattctagattcaggacttcttgccgacattcaaaattttgca
actaatgaattcagggagttagtaaagagcatgtactatagtcttgccaaaaaatacaat
agtcttgccaaaaaagcaaggtcaacaaatgaaataggattaccctttttagactttcgt
gggaaagaaaaggttataactgaagatttaaactctgacaaaggtattatagaagttgtg
gagcaggtatctagtttcatgaaaggaaaagaactaggcctagcctttatagctgcaaga
aataaactttcatctgagaagtttgaggaaattaaaaggagactctttaatttaaatgta
atatctcaagtggttaacgaagatactttaaaaaataaaagagacaaatacgatagaaat
cgacttgatctatttgtcagacacaacttactttttcaagtattatctaaacttggagta
aagtattatgtgctagattacaggttcaattatgactacatcattggaattgatgttgct
cccatgaagcgttctgagggatatataggtggtagtgccgtaatgtttgactctcaaggt
tacatacgaaaaattgtcccaattaaaattggtgaacaaagaggagaatcagttgacatg
aatgagtttttcaaagaaatggttgataaatttaaagagttcaatattaagctagataat
aagaaaatactacttctaagagatggaagaattactaataacgaagaagaagggctcaag
tatatttccgagatgtttgatattgaggtggtcacgatggacgtgataaaaaatcaccct
gtgagagcctttgctaatatgaaaatgtactttaacctaggtggtgcaatatacctaatc
ccccataagctcaaacaagctaaaggaacaccaataccaataaagttagccaaaaagagg
ataattaagaatggaaaagtcgagaagcagagtatcactagacaggacgtcttagatatc
ttcattttaactcgtcttaactatgggagtatttctgctgatatgcggttgccagcaccc
gttcactatgctcacaagtttgcaaatgcaatcagaaatgaatggaaaataaaagaagag
ttccttgctgagggatttttgtattttgtttga

DBGET integrated database retrieval system