KEGG   Pyrococcus furiosus DSM 3638: PF0967Help
Entry
PF0967            CDS       T00075                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00010  Glycolysis / Gluconeogenesis
pfu00020  Citrate cycle (TCA cycle)
pfu00620  Pyruvate metabolism
pfu00640  Propanoate metabolism
pfu00650  Butanoate metabolism
pfu00680  Methane metabolism
pfu00720  Carbon fixation pathways in prokaryotes
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01130  Biosynthesis of antibiotics
pfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF0967
   00020 Citrate cycle (TCA cycle)
    PF0967
   00620 Pyruvate metabolism
    PF0967
   00640 Propanoate metabolism
    PF0967
   00650 Butanoate metabolism
    PF0967
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PF0967
   00680 Methane metabolism
    PF0967
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PF0967
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PF0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_16 Fer4_10 Fer4_9 Fer4_4 Fer4_17 Fer4_22 Fer4_15 Fer4_8 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AAL81091
UniProt: Q51803
Position
complement(927581..927898)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaggccgatatagaaagagcccaaaaagagttaagtgaaaaa
atgacacccggagcaatagtctacattccaggaagtagcgtcattaataaaactggatct
tggagagtttttaagccagagttcaacagggacaagtgtgtaaggtgttatctctgctac
atctactgtccagagcctgcaatatacctagatgaagaaggttacccagtttttgactac
gactattgtaagggttgtggaatctgtgctaatgagtgtccaacaaaagccattgaaatg
gttagagaagttaagtga

DBGET integrated database retrieval system