KEGG   Pyrococcus furiosus DSM 3638: PF1211
Entry
PF1211            CDS       T00075                                 

Name
(GenBank) dipeptide ABC transporter, permease protein
  KO
K02034  peptide/nickel transport system permease protein
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PF1211
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF1211
Transporters [BR:pfu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    PF1211
SSDB
Motif
Pfam: BPD_transp_1 OppC_N CLLAC
Other DBs
NCBI-ProteinID: AAL81335
UniProt: Q8U1J6
Position
1152639..1153571
AA seq 310 aa
MPVGKSKFEVLKIALKNIKFKVGLGIVIFFALFAIIGPLLVPFDNMGYYPIKVGDRVIPK
PTEPALPPGSLSKVFTPNGTVEVKHYLGTDSFGRDVYAQLTYGLRSSLIVGLLAGSIATA
IGLLIGFIAGYKGGLVDEILMMITNIMLVIPTMALLIIIAAYLPYRGIGIESVIIGLTAW
PWTARAVRAQTLSLKRREFVDLSKLSGQSDLQIIFGEILPNMVSYVFMVFILQFSGAILA
AVGLDFLGLGPTKGMSLGIMLQMAVLWNAINLGYWWWAIPPGLVIAILITGLYMINLGLE
EVFNPRLRRE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccagttggaaaatcaaagtttgaagtcctcaaaatcgcgctaaaaaacataaagttt
aaagttgggcttggaatcgtcatattctttgccctattcgcgatcatcggcccattatta
gtcccctttgacaacatgggctattacccaataaaggttggggatagagtgataccaaag
ccaacagaaccagccctaccccctgggagcttatccaaagtcttcaccccaaacggaaca
gttgaggttaagcactacctgggaactgacagcttcggaagggacgtctacgctcaactg
acatatggtttgaggtcttcactaatagtaggactgctcgcgggcagtatagctacggca
atcggtctcctaataggtttcatagcgggatacaagggagggctggtggatgagatacta
atgatgatcacgaacataatgcttgtaatcccaacaatggctctactgatcataatcgca
gcctacctcccctacagaggtataggaattgagagcgttattatcggtctaacagcctgg
ccttggactgccagagctgttagagctcaaactttgtcgctgaaaaggagagagttcgtt
gatctatcaaagctaagcggtcaaagtgatctacagataatcttcggagagatacttccg
aacatggtgtcttacgtcttcatggtcttcatacttcagttcagtggagcaatattagct
gctgtaggtcttgacttccttggccttggaccaactaagggaatgtccttaggaataatg
ctccagatggcggtgttgtggaatgcaataaacctcggctactggtggtgggcaattccc
ccaggattggtcatagccatcctaattaccgggctatatatgatcaatcttggtcttgag
gaggtgtttaatccgaggttgaggagggagtga

DBGET integrated database retrieval system