KEGG   Pyrococcus furiosus DSM 3638: PF1213
Entry
PF1213            CDS       T00075                                 

Name
(GenBank) oligopeptide ABC transporter (ATP-binding protein)
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PF1213
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF1213
Transporters [BR:pfu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    PF1213
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_16 AAA_29 SMC_N NB-ARC AAA_18 TsaE AAA_5 AAA_21
Other DBs
NCBI-ProteinID: AAL81337
UniProt: Q8U1J4
Position
1154534..1155484
AA seq 316 aa
MLELENVTKTFTSGLFGGYEIRAVDGVSFKVEEGEIVSLIGESGSGKTTIGKLILRLIKP
TSGRILFKGEDIWSFDKERLRRYYYKNVQAVFQDPFASFNPLHKVDRVFDLVFKNFLGNV
GEEEKKEMIKRSLESVGLNPSEVLGKYPHQLSGGQLQRILIARALLVEPSLLIADEAVSM
LDASTRIDILNLLGEFRDRVGTSVIFITHDLALGYYISDKVVIMYRGRIVEWGDAEKIFN
NPLHPYTRMLLESVPDLNVKWEFKGIEPEREEEGIYEIQGCRYAPRCPYAREECYKKPPQ
TTQPEKNHHVACYLYK
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgcttgaactcgagaatgtgacaaaaaccttcacctcgggactctttggtggatatgag
attagggcagtggatggagtatcattcaaggttgaggagggtgagatagtaagcttgata
ggggagagtgggagtgggaagactacaatcggaaaactaatcctaaggttgattaagcca
acttctgggaggatactcttcaagggggaggacatttggagttttgacaaggagaggttg
aggaggtattattacaagaacgtgcaggcagtcttccaagaccccttcgccagcttcaac
cccctccacaaggttgacagagtcttcgacctagtattcaagaacttcctggggaatgtt
ggtgaagaggagaaaaaagaaatgatcaagaggagtttagaaagcgtaggccttaacccc
agtgaagtgttgggaaaatacccacaccagttgagtggagggcaattacaaagaatccta
attgccagggcattactcgttgaaccatcactcttgattgcagatgaggcagtgtcaatg
ctcgatgcttcaactagaattgacattctaaacttgttgggcgaattcagggatagggtt
gggacttcagtaatcttcattacacatgatttagccttgggttattacattagtgataag
gttgtgatcatgtacagggggaggattgtcgagtggggtgatgctgagaaaatcttcaac
aaccccctacacccctacacgagaatgttgctggagagtgttcctgacttgaatgtgaag
tgggagtttaaggggattgagcctgagagggaagaggaagggatttatgagattcaaggc
tgcaggtacgcgcccagatgcccttacgctagagaagaatgctacaaaaaaccaccacaa
acaacccaaccagaaaaaaaccaccacgtagcatgttatctttacaagtaa

DBGET integrated database retrieval system