KEGG   Pyrococcus furiosus DSM 3638: PF1739
Entry
PF1739            CDS       T00075                                 
Name
(GenBank) trehalose/maltose binding protein
  KO
K10236  trehalose/maltose transport system substrate-binding protein
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PF1739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF1739
Transporters [BR:pfu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter
    PF1739
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 Polyoma_coat YjbE PUA_2
Other DBs
NCBI-ProteinID: AAL81863
UniProt: O51923
Position
1614675..1616027
AA seq 450 aa
MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY
WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS
GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS
KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD
GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA
WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS
VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY
VNSALAGKISPQEALDKAQKEAEELVKQYS
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatgtcaagaaggtactgcttggtttgtttttagttggagttttggggattgcagta
gtggcaagtgggtgcattggtggccaacagacatcaacagtgacttcgactcctaccgaa
actagtttgcaaggaaagatagtatttgctgtaggaggagctccaaatgaaatagaatac
tggaaaggtgttatagctgaatttgagaagaaatatcctggggtcactgttgagctaaaa
aggcaagctactgacactgaacaaaggagacttgacttagtaaatgctttaagaggaaag
tcttctgatccagacgtatttttgatggatgttgcttggcttggtcaatttatagcctct
gggtggcttgaacctcttgatgactatgtacagaaggacaactatgacctgagtgtattt
ttccagagtgtaattaacttggcagacaagcagggtgggaagctatatgctcttccagta
tatattgatgcagggttgttgtattataggaaagacctactagaaaagtatggctatagc
aaacccccagaaacttggcaagaacttgttgaaatggctcaaaaaatacaaagtggtgag
agagagactaacccgaatttctggggatttgtatggcagggaaagcagtatgaaggtttg
gtttgtgattttgtagaatacgtatacagcaatggaggatccctaggtgaattcaaagac
ggaaagtgggtgccaactctaaataaacctgaaaatgttgaggcacttcagtttatggtg
gatctaattcacaaatataagatttctccaccaaacacatatactgaaatgacagaagag
ccagttagattaatgttccaacagggcaatgctgcattcgagagaaattggccatacgcg
tggggactacacaatgctgatgattcacctgttaaagggaaggttggagtagcaccactt
ccgcactttccaggtcataagagtgcagctacacttggaggatggcacattgggataagc
aagtactcagataacaaagcattagcttgggaatttgtcaaatttgtggaaagctacagt
gtgcaaaaaggcttcgcaatgaatctcggatggaatcctggaagagtagatgtttacgat
gatcctgctgttgttagtaaatcccctcacctaaaggaacttagagcagtttttgagaac
gcagtgccaaggccgatagttccttattatccgcagttgagtgagataattcaaaagtat
gttaattcagcactagctggcaaaatatccccacaagaagcattggacaaggctcaaaaa
gaggcagaggaattagttaaacaatacagctga

DBGET integrated database retrieval system