KEGG   Pyrococcus furiosus DSM 3638: PF1741
Entry
PF1741            CDS       T00075                                 
Name
(GenBank) trehalose/maltose transport inner membrane protein
  KO
K10238  trehalose/maltose transport system permease protein
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PF1741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF1741
Transporters [BR:pfu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter
    PF1741
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AAL81865
UniProt: O51925
Position
1616959..1617795
AA seq 278 aa
MREEVLKRILLIIGAILMAIICLFPFIWMIVVSFAEDPTFLGSPLVEYKSTLENYVRVLS
DPTLHFPAYLKNSIIIASLVTLTTVSISSLAAYAVSRIEFKGRLLIPIFVLGLSMFPQIS
LVGYLFKFIEKLGWVNTYQALYFPYVAWTLPLSLWILLSYFSQLPKDLDEAAMIDGASRI
KTLTTIILPLSAPALFSTALLVFIAAFNEFMFALLFTTDHRARTVPVGIALFQGVHGEIP
WGSVMAASVISTIPLVIMALLFQKYIVSGLTAGALKGE
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagagaggaagttctaaaaagaatattactaattatcggggccatattaatggcaata
atctgtctgtttccgtttatatggatgattgttgtttcctttgcagaggatccaacgttc
ttaggatctccgcttgtagagtataaatctactcttgagaattatgtgagggttttaagt
gatcctaccttgcatttcccagcttatttaaagaacagtataattatagccagccttgta
actcttacaactgtcagtatttcttctcttgctgcatatgcagtttcaagaatagagttc
aaagggagattactgatcccaatatttgtgctgggactctctatgtttcctcagataagt
ctagttggttatttattcaagtttatagaaaagttaggatgggtgaacacctatcaagcc
ctatatttcccttatgttgcctggacgcttcctctttcattgtggattcttctaagctac
ttttctcaacttccaaaagatttggatgaagctgcaatgattgatggagcatcccgaata
aagactctaactacgataatacttcctttatctgctcctgctttgttttcaacagcatta
ttagtgttcattgcagcatttaatgaatttatgtttgctttgttatttaccaccgatcac
agggcaagaacagtccctgtaggtatagcacttttccaaggagttcatggtgaaattcca
tggggaagcgtgatggcagcgtcggtaatctctacgatcccgcttgtaataatggcattg
cttttccagaaatacattgttagtggtttaactgctggggcactaaaaggagagtga

DBGET integrated database retrieval system