KEGG   Pyrococcus furiosus DSM 3638: PF1933
Entry
PF1933            CDS       T00075                                 
Name
(GenBank) putative sugar transport ATP-hydrolyzing
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PF1933
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfu02000]
    PF1933
Transporters [BR:pfu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    PF1933
   Maltose transporter
    PF1933
   Arabinogalactan oligomer/maltooligosaccharide transport system
    PF1933
   Raffinose/stachyose/melibiose transporter
    PF1933
   Alpha-glucoside transporter
    PF1933
   Glucose/mannose transporter
    PF1933
   Trehalose/maltose transporter
    PF1933
   Cellobiose transporter
    PF1933
   N,N'-Diacetylchitobiose transporter
    PF1933
   L-Arabinose/D-xylose transporter
    PF1933
   Fructooligosaccharide transporter
    PF1933
   Putative sorbitol/mannitol transporter
    PF1933
   Arabinooligosaccharide transporter
    PF1933
   Polygalacturonan/rhamnogalacturonan transporter
    PF1933
   Pectin-derived oligosaccharide transporter
    PF1933
   Putative multiple sugar transporter
    PF1933
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE CysA_C_terminal TOBE_2 SMC_N AAA_21 Rad17 AAA_22 AAA_16 AAA_23 AAA RsgA_GTPase AAA_25 AAA_29 ATPase_2 AAA_30 AAA_27 AAA_28 G-alpha
Other DBs
NCBI-ProteinID: AAL82057
UniProt: Q8TZQ3
Position
complement(1782299..1783411)
AA seq 370 aa
MAGVRLVGVWKQFGSFTAVKDLTLEVRDGEFLVLLGPSGCGKTTTLRMIAGLEEPTKGQI
YIGDKLVADPEKGVFVPPKDRDIAMVFQSYALYPHMTVYENIAFPLKLRKVPKQEIDKRV
REVAEMLGLTELLNRKPRELSGGQRQRVALGRAIVRRPQVFLMDEPLSNLDAKLRVKMRA
ELKKLQKQLGVTTIYVTHDQVEAMTMGDRIAVMNQGVLQQVGTPEEVYEKPANTFVAGFI
GSPPMNFLDATITEDGFLDFGEFRLKLLPDQFEVLQDYVGKEVIFGIRPEDIYDALFAQV
KIPGENMARGVVDIIENLGGEKIVHISIGGLIVTAKFPGESRVKEGDEIDIVFDMKKIHI
FNKKTGKAIL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggctggtgttaggcttgtgggtgtttggaagcagtttgggagttttactgcggtgaag
gatttaacgctggaggttagggatggtgaattcctagtcctcctcggcccctcgggctgt
ggtaagactacaactttaaggatgattgctggtttggaggaaccaacaaaaggtcaaatc
tacattggggataagctcgtcgctgatccagagaagggagtctttgttccaccaaaggat
agggatattgccatggtcttccagagctatgcattgtacccccacatgactgtttatgag
aacatcgcctttccactaaagcttaggaaggttccaaagcaggagattgacaagagggtt
agggaagttgcagaaatgcttgggttgaccgagcttttaaatagaaagccgagagagttg
agtggtgggcagaggcagcgtgtggcactaggaagggccattgttaggagacctcaagtc
ttcctaatggatgagccattgtcaaacttagatgctaaattaagggtgaagatgcgtgct
gaacttaaaaaactccaaaagcaattgggcgtgactacaatctacgtaacccacgaccag
gttgaggcaatgaccatgggtgataggattgctgtgatgaatcaaggagtattacaacaa
gttgggactccagaggaggtttatgaaaagccagcaaatactttcgtcgctggtttcatt
ggatcaccaccaatgaacttcctggatgctacgattactgaggatgggttcttggacttt
ggtgagtttaggcttaaattactcccagatcaatttgaagtcctgcaggattacgttggg
aaggaggtcatctttggcattaggcctgaagacatttacgacgcactctttgcccaagta
aagattcccggggagaatatggctaggggcgttgttgatataatcgaaaacctcggtgga
gaaaaaatcgtgcacataagcattggaggattgatagtaacagcaaaattcccaggagaa
tcaagagtcaaagaaggagacgaaatagacattgtcttcgacatgaaaaaaatccacata
ttcaacaaaaaaacaggaaaagcaatactttag

DBGET integrated database retrieval system