KEGG   Prevotella fusca: ADJ77_04210Help
Entry
ADJ77_04210       CDS       T04032                                 

Definition
(GenBank) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pfus  Prevotella fusca
Pathway
pfus00670  One carbon pool by folate
pfus01100  Metabolic pathways
pfus01120  Microbial metabolism in diverse environments
pfus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ADJ77_04210
Enzymes [BR:pfus01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ADJ77_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKU69033
UniProt: A0A0K1NJI6
Position
1:1031172..1031483
Genome map
AA seq 103 aa AA seqDB search
MKRARSIPNRSTIFNKGTFTDEPVKPFAKQAQLNVIPKTFRCNTSEVLAEMTHQCKLDEE
ARLSGTVWGAKQVKDLCAHGFNNVHFHTVSAVSSVHEAMRQLM
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcgagaagcattccgaacaggtcaaccatattcaacaaaggaacctttact
gacgaacccgtcaagccttttgccaagcaggcacagctgaatgttattccaaagacattc
cgctgcaacacctcggaagtacttgcagaaatgacgcatcagtgcaagttggacgaagag
gcacgtctgtcgggcacagtatggggtgcaaagcaggtgaaagacctctgtgcacatggt
ttcaacaatgtacatttccataccgtttcagctgtaagcagtgtacatgaagcaatgaga
caactgatgtag

DBGET integrated database retrieval system