KEGG   Pseudomonas furukawaii: KF707C_16300
Entry
KF707C_16300      CDS       T07047                                 

Gene name
bphA3
Definition
(GenBank) biphenyl dioxygenase system ferredoxin component
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
pfuw  Pseudomonas furukawaii
Pathway
pfuw00621  Dioxin degradation
pfuw01100  Metabolic pathways
pfuw01120  Microbial metabolism in diverse environments
pfuw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfuw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    KF707C_16300 (bphA3)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: BAU73318
Position
complement(1761786..1762115)
AA seq 109 aa
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDV
VECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaaatttaccagagtttgtgatcgaagagatgtgcccgaaggcgaagccctgaaggtc
gaaagtggaggcacctccgtcgcgattttcaatgtggatggcgagctgttcgcaacacag
gaccgctgcacccacggcgactggtccctgtccgatggcggctatcttgaaggtgacgtg
gtggaatgctcactgcacatggggaagttttgcgttcgcacgggcaaggtcaaatcaccg
ccgccctgtgaggcactgaagatatttccgatccgcatcgaagacaatgacgtgctggtc
gacttcgaagccgggtatctggcgccatga

DBGET integrated database retrieval system