KEGG   Pseudomonas fulva: Psefu_0012Help
Entry
Psefu_0012        CDS       T01501                                 

Definition
(GenBank) histidinol-phosphate phosphatase family protein
  KO
K03273  D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00540  Lipopolysaccharide biosynthesis
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Psefu_0012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pfv01005]
    Psefu_0012
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     Psefu_0012
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     Psefu_0012
Lipopolysaccharide biosynthesis proteins [BR:pfv01005]
 Unusual sugar
  Psefu_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 PNK3P Hydrolase Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AEF19999
UniProt: F6ABX0
Position
complement(13333..13866)
Genome map
AA seq 177 aa AA seqDB search
MKLIILDRDGVINQDSDAYIKSLEEWIPIPGSIEAIAALSKAGWTVAVATNQSGIARGYY
PLSVLEAMHARLRELVAEQGGEVGLIVQCPHGPDDGCECRKPKPGMLLQIAAHYDVPLAG
VWFVGDSASDLETALAVDCQPVLVKTGKGERTLAKAALPTGTLIFDDLAAVAARLLT
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaatcattctcgaccgcgacggagtcatcaatcaagattccgacgcctatatc
aaaagcctcgaggagtggattccgatccccggctccatcgaggccatcgccgcgctgagc
aaggcgggctggaccgtggccgtggccaccaaccagtccggcatcgcgcgcggctattac
ccgctgagcgtgctggaagccatgcatgcgcgattgcgtgagttggtggcggagcagggc
ggtgaagtcggcctgatcgtgcagtgccctcacggcccggacgacggctgcgagtgccgc
aagcccaagcccggcatgttgctccagatcgccgcgcactatgatgtgccgctcgccggc
gtgtggttcgtgggtgacagcgccagtgacctggaaacggcgctcgccgtcgactgtcag
cccgtgctggtgaaaaccggcaagggtgagcgcaccctggccaaagccgctctgccaacc
ggcaccctgatattcgacgacctggcggccgtggctgcccggcttctcacttga

DBGET integrated database retrieval system