KEGG   Pseudomonas fulva: Psefu_0245
Entry
Psefu_0245        CDS       T01501                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
pfv  Pseudomonas fulva
Pathway
pfv02025  Biofilm formation - Pseudomonas aeruginosa
pfv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psefu_0245
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Psefu_0245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfv02044]
    Psefu_0245
Secretion system [BR:pfv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psefu_0245
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 Sigma54_activat AAA_22 TniB AAA_25 AAA_7 NACHT ATPase_2 ResIII Zeta_toxin Torsin AAA_18 CbiA Hpr_kinase_C SRP54
Other DBs
NCBI-ProteinID: AEF20229
UniProt: F6AF31
Position
complement(276124..278826)
AA seq 900 aa
MSEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELSHWLHQILQLQDSDLHQIIRQF
SIEPARLAKDITEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLIVG
ILKTPSLRNALLAISREFDKLRVETLTERFDEVVGASPENALTATDGFQAGAAPGEASGA
IAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDDEIRQLVDILMRRRQNNPILTGEAG
VGKTAVVEGFALRIVAGDVPPSLKDVELRSLDVGLLQAGASMKGEFEQRLRQVIEDVQSS
PKPIILFIDEAHTLVGAGGAAGAGDAANLLKPALARGTLRTVAATTWAEYKKHIEKDPAL
TRRFQVVQVDEPSEHRAILMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELAIIGREEAIGVNIGSRRRDSESA
LAEERSRLAGLETRWSEEKALVDELLATRASLRAAAEPVDDTSREAGDARLSDEEHAAQR
SKLAELQSRLSALQGEDPLILPTVDYQAVASVVADWTGIPVGRMARNEIETVLKLDAHLK
KRIIGQDHALEMIAKRIQTSRAGLDNPNKPIGVFMLAGTSGVGKTETALALAEALYGGEQ
NVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVH
EIFFQVFDKGVMEDGEGRQIDFKNTLILLTTNAGTEMIAGLCSDPELMPEPEGIAKALRE
PLLKIFPPALLGRLVTIPYYPLSDDMLKAITRLQLERIKKRIESTHKVPFSYDDAVVDLV
VSRCTENESGGRQIDAILTNSMLPDMSREFLGRLLEGKPLAGVQVSVQNQDLHYEFAATQ
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgagtgaaatcagtcgcgccgcgttgttcggcaagctcaacagcgtcgcttacaaggcc
atcgaagccgccaccgtgttctgcaagctgcgtggcaacccctatgtcgaactgagccac
tggctgcaccagatcctgcagctgcaggattccgacctgcaccagatcatccgccagttc
agcatcgagccggcacgcctggccaaggacatcaccgaggccctggaccgcctgccgcgc
ggctccacctcgatcaccgacctgtcctcccatgtcgaggaagcggtcgagcgcggctgg
gtctacggcagcctgatgttcggcgaaagccaggtgcgcaccggctacctgatcgtcggc
atcctcaagacgccaagcctgcgcaacgcgctgctggccatctcccgggagttcgacaag
ctcagggtcgagaccctcaccgagcgcttcgatgaagtggtcggcgcctcgccggaaaac
gccctgaccgccaccgacggcttccaggccggcgctgcgccgggcgaggccagcggcgcc
atcgcgccgagcgccatgggcaagcaggaagcgctcaagcgcttcaccgtcgacctcacc
gaacaggcgcgcagcggcaagctcgaccccatcgtcggccgtgacgacgagattcgccaa
ctggtcgatatcctcatgcgccgccgccagaacaacccgatcctcaccggcgaagccggc
gtgggcaagacggcggtggtcgaaggcttcgccctgcgcatcgtcgccggcgacgtaccg
ccgagcctcaaggacgtcgagctgcgcagcctggacgtcggcctgctgcaggccggcgcc
agcatgaagggtgaattcgagcagcgcctgcgccaggtcatcgaggacgtgcagagctcg
cccaagccgatcatcctgttcatcgacgaagcccacaccctggtcggcgctggtggcgcg
gccggcgccggcgacgccgccaacctgctcaagccagccctggcccgcggcaccctgcgc
accgtggcggccaccacctgggccgagtacaagaaacacatcgagaaggacccggccctg
acccgtcgcttccaggtggtacaggtcgacgagccttccgagcatcgcgccatcctgatg
atgcgcggcgtcgcctcgaccatggaaaagcaccatcaggtgcagattctcgacgaagcc
ctggaagcttcggtcaagctgtcgcaccgctacatcccggcgcgccagttgccggacaag
tcggtcagcctgctcgataccgcctgcgcccgcgttgccatcagcctgcacgcggtgccc
gccgaggtggacgacagtcgtcgacgcatcgaagccctggaaaccgagctggccatcatc
ggccgcgaagaagccatcggcgtgaacatcggcagccgccgccgcgacagcgaatcagcg
ctggccgaagagcgcagccgccttgccggcctggaaacacgctggagcgaagagaaggcg
ttggtcgacgagctgctggccacccgcgccagcctgcgcgccgccgccgagccggtggac
gacaccagccgcgaggccggcgacgcccgcctgagcgacgaggaacacgcggcccagcgc
agcaagctcgccgagctgcagagccgcctgagcgccctgcagggcgaagacccgctgatc
ctgccgaccgtcgattaccaggcggtggcctcggtggtcgccgactggaccggcattccg
gtcgggcgcatggcgcgcaacgagatcgagaccgttctcaagctggacgcgcacctgaag
aaacgcatcatcggccaggaccacgccctggaaatgatcgccaagcgcatccagacctcc
cgcgccgggctcgacaaccccaacaagccgatcggcgtattcatgctcgccggcacctcc
ggcgtgggcaagaccgaaaccgccctggcgctggccgaagccctgtatggcggtgagcag
aacgtcatcaccatcaacatgagcgagttccaggaagcccacacggtgtccaccctcaag
ggcgcgccaccgggctacatcggctacggcgagggcggcgtactgaccgaagcggtgcgc
cggcgcccctacagcgtagtgttgctcgacgaggtcgagaaggcgcacccggatgtccac
gagattttcttccaagtgttcgacaagggcgtgatggaagacggcgaaggccgccagatc
gacttcaagaataccctgatcctgctcaccaccaacgccggcaccgagatgatcgccggg
ctgtgcagcgacccggagctgatgcccgagcctgaaggcatcgccaaggcgctgcgcgag
ccgctgctgaagatcttcccgccggccctgctcggccgcctggtgaccatcccctactac
ccgctgtcggacgacatgctcaaggccatcacccgcctgcagctggagcgcatcaagaag
cgcatcgaaagcacccacaaggtgccgttcagttacgacgatgcggtggtcgacctggtg
gtgtcgcgctgcaccgagaacgagagcggtggccggcagatcgacgcgatcctcaccaac
agcatgctgccggacatgagccgcgagttcctcggccgcctgctcgaaggcaaaccgctc
gccggcgtgcaggtcagcgtgcagaaccaggatctgcactatgagtttgcggcaacgcag
taa

DBGET integrated database retrieval system