KEGG   Pseudomonas fulva: Psefu_0249Help
Entry
Psefu_0249        CDS       T01501                                 

Definition
(GenBank) virulence protein SciE type
  KO
K11898  type VI secretion system protein ImpE
Organism
pfv  Pseudomonas fulva
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfv02044]
    Psefu_0249
Secretion system [BR:pfv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Psefu_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE TPR_19 TPR_14
Motif
Other DBs
NCBI-ProteinID: AEF20233
UniProt: F6AF35
Position
complement(282192..282992)
Genome map
AA seq 266 aa AA seqDB search
MTAEQYLRNAQLDDALKALQDQVRAQPAKAELRVFLFQLLAVMGQWSRAQNQLKVAGELD
AACLPMVQTYSTALNCEALREQVFAGKTTPVVLGQPAEWVAPLILALEQDAQGNAAAAQS
LRDQAFEAAAAVPGTLDDTPFTWLADADPRLGPVLELIVNGRYVWLPMENIASLAVEAPS
DLRDLVWLPAQLTLTNGGSTVALIPSRYPGTHASSDGALRLARKTEWQDDGVPLGQRLLA
FDGGDQALFDLRTLSFEHGNAAAWPT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgaacaatacctgcgtaacgcacagctcgacgacgcgctgaaggcgctgcag
gaccaggttcgggcgcaaccggccaaagccgaactgcgcgtgttcctgttccagctgctg
gcggtgatgggccaatggagccgtgcgcagaatcagctgaaggtcgccggcgagctggac
gccgcctgcctgccgatggtgcagacctacagcacggcgctgaactgcgaggctctgcgc
gagcaggtgttcgccggcaagaccacgcccgtggtgctcggccagcccgccgaatgggtc
gcgccgctgattctcgccctcgaacaggacgcccagggcaatgctgccgccgcccagagc
ctgcgtgaccaggccttcgaagcggctgccgcggtgccgggcacgctcgacgacaccccc
ttcacctggttggccgacgccgacccgcgccttggcccggtgctggaactgatcgtcaac
ggtcgctacgtctggctgcccatggaaaacatcgccagcctcgccgtcgaagcacccagt
gatttgcgtgacttggtctggctgccggcccagttgaccctgaccaacggcggcagcacc
gtggcgctgatccccagtcgctaccctggaacacacgccagcagcgacggtgcactgcgc
ctggcccgcaagaccgaatggcaggacgacggcgtaccgctcggccagcgtctgctggcc
ttcgatggcggcgaccaggcgctgttcgatctgcgcacgctgagcttcgagcacgggaat
gctgcggcatggccgacctga

DBGET integrated database retrieval system