KEGG   Pseudomonas fulva: Psefu_0795Help
Entry
Psefu_0795        CDS       T01501                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00430  Taurine and hypotaurine metabolism
pfv00460  Cyanoamino acid metabolism
pfv00480  Glutathione metabolism
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Psefu_0795
   00460 Cyanoamino acid metabolism
    Psefu_0795
   00480 Glutathione metabolism
    Psefu_0795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfv01002]
    Psefu_0795
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Psefu_0795
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Psefu_0795
Peptidases and inhibitors [BR:pfv01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Psefu_0795
CD molecules [BR:pfv04090]
 Proteins
  Psefu_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AEF20773
UniProt: F6A8U5
Position
complement(861384..862994)
Genome map
AA seq 536 aa AA seqDB search
MLSFSAHRYPYASQRQSVFARRGMVAASQPLAAEAGIDIMRRGGNAIDAAIATAAALTVV
EPTGCGIGGDAFALVWVKGQLHGLDASGHAPAALNIETVKAAGHKEMPLYGWTPVTVPGC
PSAWAELSRRFGRLPFAELLAPAISLANDGFPLSPVVAHQWQVALDDFSARREPAMQAWF
DTFLIDGRAPKAGELFRNPAQARTLQALADSQCESFYRGELAETIDQASRAAGGYLRKED
LQGYKPRWVDPISVNYRGYDVWEIPPSGQGLVALMTLQILQGFEFDHRDSLQTWHRQIEA
LKLAYSDGLHHITDPEHMRVAVADLLSPGYTERRRKLIGERAIQPQAGDPHASGTVYLAA
ADGEGNMISFIQSNYHGFGSGVVVPDTGIALQNRGQEFSLDANHANALVAGKKTFHTIIP
GFLTKDGEAVAPFGVMGGYMQPQGHVQMVMNLVDFGLNPQAALDAPRWQWMGDRKVGIEQ
AAPRDLAVALARMGHQVNVECDSTDYGRGQIIVRDPQTGVLCGGTEPRADSHIAVW
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtttttccgcccaccgctatccctatgcttcgcagcgccagagcgtattcgcc
cggcgcggcatggtggcggcttcgcaacccctggccgccgaggccggcatcgacatcatg
cgtcgcggtggcaacgccatcgatgccgccatcgccacggctgccgcgctgacggtggtc
gaacccaccggctgcggcatcggcggtgacgccttcgcgctggtctgggtcaaaggccag
ctgcacggcctggacgccagcggccacgcgcctgcggccctgaacatcgaaaccgtcaaa
gccgccggccacaaggagatgccgctgtacggctggacgccagttaccgtaccgggctgc
ccgtcggcctgggccgaactgtcgcgccgcttcggccgcctgccattcgccgaactgctc
gcacctgcaatcagcctggctaacgatggcttcccgctgtcgccggtggtcgcccaccag
tggcaggtcgccctggatgatttctccgcgcgccgcgagccggccatgcaggcctggttc
gatacctttctgatcgacggccgtgcaccgaaagccggcgagctgttccgtaacccggcc
caggcgcgcaccctgcaggcgctggcggacagccagtgcgagagtttctaccgcggcgag
ctcgccgagaccatcgaccaagcctcgcgggccgccggcggctacctgcgcaaggaagac
ctgcaaggctacaagccgcgctgggtcgacccgatcagcgtcaactaccgtggctatgac
gtgtgggaaatcccgccgagcggccagggcctggtcgccctgatgaccctgcagattctc
cagggcttcgagttcgatcaccgcgacagcctgcaaacctggcaccgccagatcgaggcg
ctgaagctggcctacagcgacggcctgcaccacatcaccgaccccgagcacatgcgcgtc
gcggttgccgacctgctcagcccgggttacaccgaacgccgccgcaagctgatcggcgag
cgcgcgatccagccgcaagccggcgacccgcacgccagcggcaccgtctacctggccgcc
gccgatggcgaaggcaacatgatctcgttcatccagagcaactatcacggcttcggctcc
ggcgtcgtggtgccggacaccggcatcgccctgcagaaccgtggtcaggaattcagcctg
gacgccaaccacgccaacgccctggtcgccggcaagaagaccttccacaccatcatccca
ggcttcctgaccaaggacggcgaagcggtcgcgccgttcggcgtgatgggcggctacatg
cagccccaggggcatgtgcagatggtcatgaacctggtcgacttcggcctcaacccccag
gccgcgctggatgctccgcgctggcaatggatgggcgacaggaaggtcggcatcgaacag
gcagccccgcgtgacctggccgtggccctggcgcgcatgggccaccaggtcaacgtggaa
tgcgactccaccgactacggccgcgggcagatcatcgtgcgtgatccacaaactggcgtg
ctgtgcggcggcaccgagccacgggcggactcgcatatcgccgtgtggtaa

DBGET integrated database retrieval system