KEGG   Pseudomonas fulva: Psefu_0929Help
Entry
Psefu_0929        CDS       T01501                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00471  D-Glutamine and D-glutamate metabolism
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Psefu_0929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfv01011]
    Psefu_0929
Enzymes [BR:pfv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Psefu_0929
Peptidoglycan biosynthesis and degradation proteins [BR:pfv01011]
 Precursor biosynthesis
  Racemase
   Psefu_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEF20907
UniProt: F6AAG2
Position
1009229..1010023
Genome map
AA seq 264 aa AA seqDB search
MRDAPIGVFDSGVGGLTVLREIRTLLPQETLFYVADSGHVPYGEKSPEYIRERCRFIASF
LLERGAKALVLACNTATVAGVGELRTLYPQLPIVAMEPAVKPAAAATRSGVVGVLATTGT
LKSARFAALLDQFANDVRVVTQPCPGLVELIEAGDLNDPALHGLLRGYVEPLLAEGCDTL
ILGCTHYPFLRPLLEQWLDPSISLIDTGAAVARQLQRLLASRDLLANGPRDVDRFWCSGE
PAAMQRVLPQLWGSAEPVAALPEN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgacgcgccgatcggggtattcgattccggcgtgggcggcctcacggtattgcgg
gaaatccgcaccttgctgcctcaagaaaccctgttctacgtggccgacagcggccacgtg
ccttacggcgaaaagagccccgagtacattcgcgagcgctgccgattcatcgcctcgttt
ctgctcgagcgcggcgccaaggccctggtgctggcctgcaacaccgcgacggtcgctggg
gtgggcgagctgcgcactctgtatccgcagttgccgatcgtggccatggagccggcggta
aagcctgccgccgccgcgacgcgctccggtgtggtcggtgtgctggccaccaccggcacg
ctgaaaagcgcgcgcttcgctgccttgctcgaccagttcgccaatgatgtgcgggtggtc
acgcagccttgcccagggttggtcgagctgatcgaggcgggcgatctgaacgacccggcc
ctgcatggcctgctgcgtggttacgtcgagccgctgttggccgagggctgtgacacgctg
attctgggctgcactcactatcccttcctgcgcccgttgctcgaacagtggctggatccg
tcgatcagcctgatcgacaccggcgctgcggtggcccggcaactgcaacggttgctggcc
agccgcgacctgctggccaacgggccgcgcgacgtggaccgcttctggtgcagcggcgag
ccggcggccatgcagcgcgtgctgccgcagctgtggggtagcgctgagccggtggctgcg
ttgcccgaaaattaa

DBGET integrated database retrieval system