KEGG   Pseudomonas fulva: Psefu_2059Help
Entry
Psefu_2059        CDS       T01501                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv00052  Galactose metabolism
pfv00500  Starch and sucrose metabolism
pfv00520  Amino sugar and nucleotide sugar metabolism
pfv00521  Streptomycin biosynthesis
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
Module
pfv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_2059
   00052 Galactose metabolism
    Psefu_2059
   00500 Starch and sucrose metabolism
    Psefu_2059
   00520 Amino sugar and nucleotide sugar metabolism
    Psefu_2059
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psefu_2059
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Psefu_2059
Enzymes [BR:pfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psefu_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEF22030
UniProt: F6A9V8
Position
2199946..2200911
Genome map
AA seq 321 aa AA seqDB search
MSLALVGDIGGTNARFALWRDGGLHGVRVSATADHATVEQAIVAYLAAEGLALGEVQTIC
LACAGPVEIDPFRFTNNAWRIDRQAFCAELQVRELLLLNDFSAMALGMTCLQEDEYVTVC
PGEAQPGRPAVVIGAGTGLGVGTLLSLPDGSWHALPGEGGHVDLPVGSNREALIWQALHR
QLGHVSAEAGALSGNGLLALYRATCAVDGQQASLQSAAQVTRAALEGEPLAVGVLEQFCC
LLGRVAGNNVLTVGGRGGVYIAGGMVPRFADFFLASGFSRSLRDKGCMSDYFDGLPVWLV
TAPYPGLVGAGVAVEQHLQRN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggcgctggtgggcgacatcggcggcaccaatgcgcgtttcgccctgtggcgt
gacggcggcctgcatggcgtgcgggtatcggcgactgccgatcacgccaccgtcgaacag
gccatcgtcgcctacctggccgcggaaggtctggcgctcggcgaagtgcaaaccatctgc
ctggcctgcgccgggccggtggagatcgacccgtttcgtttcaccaacaacgcctggcgc
atcgaccgccaggcgttctgcgccgagctgcaggtgcgcgagctgctgctgctcaacgat
ttttccgccatggccctgggcatgacctgcctgcaggaagacgagtacgtcaccgtctgc
ccgggcgaggcgcaaccaggtcgcccggccgtggtgatcggtgccggcaccggcctgggc
gtcggcaccttgctgagcctgcccgatggcagctggcacgccttgccgggcgagggtggt
cacgtcgacctgccggtgggcagtaaccgcgaggcgttgatctggcaggcgctgcaccgc
cagctcggccacgtcagcgccgaggctggtgcgctcagcggcaatggcctgctggccttg
tatcgcgcgacctgtgcagtggatggtcagcaggcttcgctgcaaagcgccgctcaggta
acccgcgcggcgctggaaggcgagccgctggcggttggcgtgctggaacagttctgctgc
ctgctgggccgcgtcgccggcaataacgtgctgaccgtcggcggccgcggcggcgtgtat
atcgccggcggtatggtgccgcgcttcgccgatttcttcctggccagcggtttctcccgt
agcctgcgcgacaagggctgcatgagcgattacttcgacggcctgccggtttggctggtg
accgcgccttacccggggctggtcggcgcgggcgtggcggtggagcagcacctgcagagg
aactag

DBGET integrated database retrieval system