KEGG   Pseudomonas fulva: Psefu_2127
Entry
Psefu_2127        CDS       T01501                                 
Name
(GenBank) CagE, TrbE, VirB component of type IV transporter system, conserved region
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pfv  Pseudomonas fulva
Pathway
pfv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Psefu_2127
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfv02044]
    Psefu_2127
Enzymes [BR:pfv01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Psefu_2127
Secretion system [BR:pfv02044]
 Type IV secretion system
  Trb secretion system protein
   Psefu_2127
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 TraG-D_C AAA_16 FtsK_SpoIIIE DUF87 NACHT Zot T2SSE
Other DBs
NCBI-ProteinID: AEF22098
UniProt: F6AAP5
Position
complement(2265940..2268369)
AA seq 809 aa
MLNLTEYQRRPAQLADWLPWAGLVAPGVVLNKDGSFQRSLRFRGPDLDSATQGELVATSA
RLNNALRRLGSGWALFVEAERLAAADYPNSDFPEPLSWLVDEERRAACEAQGSHFESSYH
LTLVYLPPEESRSRAAGLLYEHRPQRDVDWRERLTAFVAETDRFFDLLDGVMPELAWLDD
SQTLTYLHATVSTHRQRLAVPEVPFHLDALLADSPLTTGLAPRLGEQHLRTLSVRGFPTS
TWPGVLDDLNRLGFAYRWSTRFICLEKDEAEKELVRLRRQWFAKRKGVLALLREAIFQQE
SPLLDSDAANKAGDADEALQELGADQVAFGYVTATVMVSDVDAQIADEKLRRVERVIQGR
GFVTIAESLNAVEAWLSSIPGNVYANVRQPLISTLNLAHLMPVSAVWAGPARNEHLDGTP
LVITRTDGATPFRLVTHVGDVGHTLVAGPTGMGKSVLLATLALQFRRYPGSRLFLFDMGR
SLRATVLGLGGEHYNLGGDGDLAFQPLARIDQPGYRAWAADWLEARLLQEGVAVDPEQKA
ALWTALDSLAGAPEAQRTLTGLSVLLQDNILRQALQPYVLGGAHGALLDAEQDRLGNADV
QCFEMEELMYSKAAVAAVLSYLFARFEERFDGAPTLLILDEAWLFLDDPLFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAAAIIESCASRIFLPNPQAGEPQIRGIYQGFGLNDR
QIEIIAQATPKRDYYYQSRLGSRLFDLDLGPVALAFAASASPAEQREIDRILQTSGAADF
APAWLHHRGLDWAADLLTAYPSSRKECLP
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgctgaacctcaccgaataccagcgccgccccgcccagctcgccgactggctaccctgg
gccggtctggtcgcacccggcgtcgtattgaacaaggacggttcgttccaacgcagcctg
cgctttcgcgggccagacctggacagcgccacccaaggcgagctggtggccacctcggcg
cgcctgaacaatgccctgcgtcgccttggctcgggctgggcgctgtttgtcgaggccgag
cgtctggcggcggccgattaccccaacagcgactttcccgaaccactgtcctggctggtg
gacgaggagcgccgcgccgcctgcgaggcccagggcagccacttcgagagcagctatcac
ctgacgctggtctacctgccgccggaagaatcgcgctcgcgcgccgccggcctgctctat
gagcaccggccgcaacgcgacgtcgactggcgcgaaaggctgactgcctttgtcgccgaa
acggatcgtttcttcgatctgctggacggggtgatgccggagctcgcctggctcgatgac
agccagacgctgacttacttgcatgccacggtttcgacccatcgccagcggttggctgta
cccgaggtgcccttccacctcgatgccctgctggccgacagccccctgaccacgggccta
gcgccgcgtctcggtgagcagcatctgcgcacgctgtcggtacgtggcttccccacctcg
acctggccaggcgtgctggacgacctcaaccgtctgggcttcgcctatcgctggtcgacc
cgctttatctgcctggaaaaggacgaggccgagaaggaactggtgcgcctgcgcaggcag
tggttcgccaagcgcaagggcgtcctggcactactgcgcgaagcgattttccagcaggaa
agcccactgctcgacagcgacgccgcgaacaaggccggcgacgccgacgaggcactacag
gaactcggcgccgaccaggtcgccttcggctatgtgacggccaccgtgatggtgagcgat
gtcgacgcccagatcgccgacgagaagctgcgccgggtcgagcgggtaatccagggccgc
ggcttcgtcaccatcgccgagagtctcaacgcggtggaggcgtggctatcgtcgatcccc
ggcaacgtctacgccaatgtccgccagccgctgatctccacactcaacctggcgcacttg
atgccggtctcggcagtctgggctgggccggcacgcaacgaacatctggatggcacgcca
ttggtgatcacccgcaccgatggagcaacaccatttcgcctggtcacccacgttggcgat
gtcggacacaccttggtggctggccccacgggcatgggcaaatcggttttgctggcaacc
ctggccctgcagttccgccgctacccgggctcgcgcctgtttctgttcgatatggggcgc
tcgctgcgcgcaacggtgctgggcctgggtggcgagcactacaacctcggaggcgacggc
gacctggccttccagcctctggcgcgcatcgatcagccgggataccgagcctgggccgcc
gattggctggaggcgcgcctgctgcaggaaggtgtggccgtcgaccccgagcagaaagcc
gcgctgtggacggcgctggacagtctggccggcgcgcccgaagcgcagcgcacactgacc
ggtttatccgtgctgctgcaggacaacatcctgcgccaggcgctgcagccctacgtgctg
ggcggcgcgcatggcgcattgctggatgccgagcaggatcgtctgggcaacgccgacgtg
cagtgtttcgagatggaggaactgatgtacagcaaggcggcggtggctgccgtgctgagc
tacctgttcgcccgtttcgaggagcgctttgacggcgcgccgacactgctgatcctcgac
gaggcctggctgtttctcgacgatccgctattcgccgcgcgcatccgccagtggctcaag
accctgcgcaagaagaacgtcagcgtcatcttcgccacccagtcgctggccgacatcaag
gactccagcatcgctgccgcgattatcgagagctgcgccagccgcatcttcctacccaac
ccgcaggcgggcgagccgcagatccgcggcatctaccaaggcttcggactgaacgaccgg
cagatcgagatcatcgcccaggccacgcccaagcgtgattactactaccagtcgcgcctg
ggcagccgcctgttcgacctcgacctcgggccggtggcgctggccttcgctgcctcggcc
agcccggccgagcagcgcgagatcgaccgaattttgcagacgtccggcgccgccgatttc
gcccctgcctggttgcatcaccgcggcctggattgggccgccgacctgctcaccgcttat
ccctcgtcacgcaaggagtgcctgccatga

DBGET integrated database retrieval system