KEGG   Pseudomonas fulva: Psefu_2316Help
Entry
Psefu_2316        CDS       T01501                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00630  Glyoxylate and dicarboxylate metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psefu_2316
Enzymes [BR:pfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Psefu_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEF22283
UniProt: F6ACA1
Position
complement(2486536..2488131)
Genome map
AA seq 531 aa AA seqDB search
MSAYENDIKAVTALKEAAGNSWSAINPESVARMRAQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMIAALRSDFGPLPDQSM
HEKTAVAALIEELYTFLRQADARELDLLFSALDAARESGDRAKQSEIQAQIDNFETHVVP
IIADIDAGFGNPEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTSEPGDLGDQYNSFLDCDEISPAELK
NGDVVINREGKLLRPKRLPSNLFQFRKGTGEDRCVLDSITSLQNGADMIWIETEKPHVGQ
IKAMVDRVREVIPNAKLVYNNSPSFNWTLSFRQQVFDAFVAEGKDVSAYDRAKLMSAEYD
ETELAQVADEKIRTFQRDGSANAGIFHHLITLPTYHTAALSTDNLAKGYFADLGMLAYVK
GVQRQEIRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKAGGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttacgaaaacgacatcaaagccgttaccgccctgaaagaagccgctggcaac
agctggagcgcgatcaacccggaatccgtcgctcgtatgcgcgcccagaaccgcttcaag
accggcctggatatcgccaagtacaccgccgccatcatgcgcaaggacatggccgagtac
gatgccgactcgtctgtctacacccagtcgctgggctgctggcacggtttcatcggccag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgttacctctatctg
tccggctggatgatcgccgcgctgcgctccgacttcggcccgctgccggatcagtcgatg
cacgagaagactgcggtcgccgcgctgatcgaagagctgtacaccttcctgcgccaggcc
gatgcccgcgagctggatttgctgttcagcgccctcgacgccgctcgcgaatcgggggac
cgcgccaagcagagcgagatccaggcgcagatcgacaatttcgaaacccacgtggtgccg
atcatcgccgacatcgatgccggtttcggcaaccccgaggccacctacctgctcgccaag
aagatgatcgaagccggcgcctgctgtatccagatcgagaaccaggtctccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgtgccccatgccgacttcctcgccaagatc
aacgcggtacgctacgccttcctcgaactgggcgtggacgacggcgtgatcgtcgcccgt
accgattctctgggtgccggcctcaccaagcagatcgccgtgaccagcgagccgggcgac
ctgggtgatcaatacaactcgttcctggattgcgacgaaatcagcccggccgagctgaag
aacggcgacgtggtgatcaaccgcgaaggcaagctgctgcgccccaaacgcctgccgtcc
aacctgttccagttccgcaagggtaccggcgaggatcgctgcgtactggacagcatcacc
tcgctgcagaacggcgcagacatgatctggatcgagaccgagaagccccatgtcggccag
atcaaggccatggtagatcgcgtgcgcgaagtcatccccaatgccaaactggtctacaac
aacagcccgtcgttcaactggaccctgagcttccgccagcaggtgttcgatgccttcgtc
gccgagggcaaggatgtatcggcctacgaccgcgccaagctgatgagcgccgagtacgac
gaaaccgaactggcccaggttgccgacgagaagatccgcaccttccagcgcgacggatcg
gccaatgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctt
tccaccgacaacctggccaagggctacttcgccgacctgggcatgctggcctacgtcaag
ggcgtgcagcgccaggaaatccgtcagggtatcgcctgcgtcaagcaccagaacatggcg
ggctcggacatcggcgacaaccacaaggaatacttcgccggagaagccgcactcaaagcc
ggcggcaaggacaacaccatgaaccagttccactga

DBGET integrated database retrieval system