KEGG   Pseudomonas fulva: Psefu_2325Help
Entry
Psefu_2325        CDS       T01501                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00020  Citrate cycle (TCA cycle)
pfv00480  Glutathione metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
pfv01210  2-Oxocarboxylic acid metabolism
pfv01230  Biosynthesis of amino acids
Module
pfv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psefu_2325
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psefu_2325
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Psefu_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AEF22292
UniProt: F6ACB0
Position
complement(2495569..2497797)
Genome map
AA seq 742 aa AA seqDB search
MTTRSKIIYTLTDEAPALATYSLLPIVKAFTASSDIAVETRDISLAGRILALFPEFLTDA
QKQGDHLAELGALATTPEANIIKLPNISASVPQLKAAIKELQSQGYALPDYPDADDSEQA
RDIRSRYDKVKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWAADSKSHVAHMESG
DFYGSEKAALIDAKGSVKIELIGADGSTTVLKEKTSVLADEVLDCSVMSKKALRSFIAAQ
IEDAKKQGVLFSVHLKATMMKVSDPIIFGQIVAEFYKPALEKHAAALQEAGFNLNNGIGD
LYASIKKLPADKQAEIEADINAVYADRPALAMVNSDKGITNLHVPSDVIVDASMPAMIRD
SGRMWNTAGELQDAKAVIPDRCYAGIYQAVIEDCKANGAFNPTTMGSVPNVGLMAQKAEE
YGSHDKTFQIQAAGVVRVSDANGKVLMEQKVEEGDIFRMCQTKDAPIQDWVKLAVNRARL
SNTPAVFWLDPARAHDAEMIKKVEKYLKDHDTSGLDIRILAPVDAIKFSLARIREGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLVEENFL
RWDSLGEFLALAASLEHLGNTYDNPKALVLSKTLDQATGQFLDNDKSPARKVGGIDNRGS
HFYLALYWAQALAAQSEDAALKAQFAPLAKTLTDNEAKIVAELGAVQGKPADIGGYYAPN
KELTEKVMRPSATLNAALASLA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacgctcgaagatcatttacaccctcaccgacgaagccccagcgctcgcgacc
tactccctgctccccatcgtcaaagccttcaccgcctcctccgatatcgccgtcgagacc
cgcgacatttcgctggccggccgtatcctggcgctgtttccggagtttctgaccgacgcg
cagaaacagggcgaccaccttgcagagctgggcgcactggccaccacgccagaagccaac
atcatcaagctgccgaacatcagcgcctcggtaccgcagctcaaggccgccatcaaggaa
ctgcagagccagggttatgccctgcccgactacccggacgccgatgacagcgaacaggcc
cgcgacatccgcagccgctacgacaaggtcaagggcagcgccgtgaacccggttctgcgc
gaaggcaactccgaccgccgcgcaccgctgtcggtcaagaactatgcccgcaagcacccg
cacaagatgggcgcctgggctgccgactccaaatcccacgtggcgcacatggaaagcggc
gacttctacggcagcgagaaagcggccctgatcgacgccaaaggcagcgtgaagatcgag
ctgatcggcgctgacggcagcaccaccgtgctgaaagagaagaccagcgtgctggctgac
gaggtcctggattgctcggtcatgagcaagaaggccctgcgcagcttcattgccgcccag
atcgaagacgccaagaagcaaggcgtgctgttctcggtacacctgaaggccaccatgatg
aaggtctccgacccgatcatctttggccagatcgttgccgagttctacaagccagccctg
gaaaagcacgctgctgccctgcaggaagccggcttcaacctgaacaacggtatcggcgac
ctgtacgccagcatcaagaagctgccagccgacaagcaggctgaaatcgaagcggacatc
aacgccgtgtacgccgatcgtccggcgctggcgatggtcaactccgacaagggcatcacc
aacctgcacgtgccgagcgacgtgatcgtcgacgcctcgatgccggcgatgattcgcgac
tcgggccgcatgtggaacaccgcgggtgagctgcaggacgccaaggccgtgatcccggat
cgctgctacgccggtatctaccaggccgtgatcgaagactgcaaggccaatggcgccttc
aacccgaccaccatgggcagcgtgccgaacgttggcctgatggcacagaaagccgaagag
tacggctcccacgacaagaccttccagatccaggccgccggcgtggttcgcgtcagcgat
gccaacggcaaggtactgatggagcagaaggtcgaggaaggcgacatcttccgcatgtgc
cagaccaaggacgcgccgatccaggattgggtcaagctggccgtcaaccgtgcccgcctg
agcaacaccccggcggtgttctggctggacccggctcgtgcccacgacgccgaaatgatc
aagaaggtcgagaagtacctgaaggatcacgacaccagcggcctggacatccgcatcctc
gctccggtcgacgccatcaagttctccctggcacgcattcgcgaaggcaaggacaccatt
tcggtgaccggcaacgtactgcgcgactacctgaccgacctgttcccgatcatggagctg
ggcaccagcgccaagatgctgtctatcgtgccgctgatgaacggcggcggcctgttcgaa
actggcgcaggcggctcggcgcccaaacacgtgcaacagctcgtcgaagagaacttcctg
cgctgggattccctgggtgagttcctggccctggccgcttccctggagcacctgggtaac
acctacgacaacccgaaagcactggtgctgagcaagactctggaccaggccaccggccag
ttcctcgacaacgacaagtcgccggcgcgcaaggttggcggtatcgacaaccgtggcagt
cacttctacctggcgctgtactgggcccaagccctggcggcccagagcgaagacgccgcc
cttaaggcgcagttcgctccactggccaagaccctgaccgacaacgaagccaagatcgtt
gccgagctcggcgcggtacagggcaaaccggcagacatcggtggctactacgccccgaac
aaggagctgaccgaaaaagtcatgcgcccgagcgcgaccctcaacgctgccctggcttcc
ctggcctga

DBGET integrated database retrieval system