KEGG   Pseudomonas fulva: Psefu_2490Help
Entry
Psefu_2490        CDS       T01501                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00020  Citrate cycle (TCA cycle)
pfv00640  Propanoate metabolism
pfv00660  C5-Branched dibasic acid metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
Module
pfv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psefu_2490
   00640 Propanoate metabolism
    Psefu_2490
   00660 C5-Branched dibasic acid metabolism
    Psefu_2490
Enzymes [BR:pfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Psefu_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEF22455
UniProt: F6AEM9
Position
complement(2676852..2678018)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAAACEKIGGTEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAANWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVAQFAKI
FVGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LADSGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgcccgtatcc
aagggctttgccgtagacaccccggaagaggccgcagcggcctgtgaaaaaatcggcggg
accgagtgggtcgtcaaggctcaggtacacgctggtggccgcggtaaagcgggcggtgtg
aaactggtcaagagcaaggaagacgccaaggctttcgctgccaactggctgggcaagcgc
ctggtgacctatcagactgacgccaatggccagcctgtcaccaagatcctggtcgagtcc
tgcaccgacatcgccaaggaactgtacctgggcgcggtcgttgaccgttccagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaagatcgctcacgacacc
cctgagaagatcctcaaggcgaccatcgatccgctggtcggcgctcagccgttccagggc
cgcgagctggcattccagctgggtctggaaggcaagcaagtcgctcagttcgccaagatc
ttcgtaggcctggccaagctgttccaggaccacgatctggccctgctggaagtcaacccg
ctggtcatcaaggccgacggcgacctgcactgcctggacgcgaagatcaacatcgacgcc
aacgccatgtatcgtcagccgaagctgaagaccttccacgacccgtcgcaagacgatgcc
cgtgaagcccatgccgccaagttcgaactgaactacgtcgcgctggaaggcaacatcggc
tgcatggtcaacggtgccggtctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctggacgttggcggcggcgcgaccaaagagcgcgtgaccgaa
gcattcaagatcatcctgtccgacagcaacgtcgctgccgttctggtgaacatcttcggc
ggtatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagttggc
gttaaggttccggttgtcgtccgtctggaaggcaacaacgctgaactgggtgccaaggta
ctggccgacagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgctcagcaa
gtcgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system