KEGG   Pseudomonas fulva: Psefu_3139Help
Entry
Psefu_3139        CDS       T01501                                 

Definition
(GenBank) Glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00030  Pentose phosphate pathway
pfv01100  Metabolic pathways
pfv01120  Microbial metabolism in diverse environments
pfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psefu_3139
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Psefu_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b DUF3726
Motif
Other DBs
NCBI-ProteinID: AEF23102
UniProt: F6A9A1
Position
complement(3362396..3363196)
Genome map
AA seq 266 aa AA seqDB search
MLISLQSQVALVTGASSGIGAASAKALAEAGAAVVLNYRSGREAAERLAAEIRDGGGQAI
AVKADVSSEAEVEALFAETLSAFGRLDILLANSGMQRDAPTVDMSLDEWNQVLQVNLTGQ
FLCVRAALRQFAKQGIREEISRAAGKIIQMSSVHQLIPWAGRANYAASKGGLDLLMRSVA
QEVGEQRIRVNAIAPGAIRTAINRDATEGEAAEKLLELIPYGRIGDAEDIANAVVWLASD
MADYVHGTTLFIDGGMSLYPEFRDNG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgctcatctctctgcagtcacaggtcgcgctggtcactggcgcgagttcgggtatcggc
gcggcctcggccaaggccttggccgaggcgggcgccgcggtggtgctcaactaccgttcc
gggcgcgaggccgccgagcggcttgccgccgaaatccgtgatggcggcggccaggccatc
gccgtgaaggcggatgtgtccagcgaggcggaggtcgaggcgctgttcgccgaaaccctc
tccgcgttcgggcgcctggacattctgctggccaattccggcatgcaacgcgacgcgccg
accgtggacatgagcctggacgagtggaaccaggtgctgcaggtcaacctcaccggccag
tttctctgcgtgcgcgcggcgcttcggcagttcgccaagcagggcattcgcgaggagatt
tcccgcgcggccggcaagatcatccagatgagttccgtgcaccagctgattccctgggcc
gggcgcgccaactacgcagcctccaagggcgggctcgatcttttgatgcgcagcgtggcg
caagaggtgggcgagcagcgcatccgcgtcaacgccattgcgccgggagcgatccgcacg
gcgatcaatcgggatgccaccgaaggcgaggcggccgaaaagctgctcgaactgatcccc
tatggccgcatcggcgacgccgaggacatcgccaatgcggtggtgtggctggcctccgac
atggccgattacgttcacggcaccacgctgttcatcgacggcggcatgagcctttacccg
gagtttcgcgacaatggctga

DBGET integrated database retrieval system