KEGG   Pseudomonas fulva: Psefu_3373Help
Entry
Psefu_3373        CDS       T01501                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00480  Glutathione metabolism
pfv00590  Arachidonic acid metabolism
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Psefu_3373
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psefu_3373
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Psefu_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEF23335
UniProt: F6ABS6
Position
complement(3629322..3629804)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLHALDGQELPLAPLKGKVVLVVNVASKCGLTPQYAGLERLQQTYAAQGFSVL
GVPCNQFAGQEPDDEAAIAQFCSLNYGVTFPLSSKLEVNGSGRHPLYRLLAGEGAEFPGD
ITWNFEKFLVGQDGRVLARFSPRTAPDDPALIQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttccacgacctgacactgcacgcattagatggccaggagctgccgctggcg
ccgctcaagggcaaggtggtgctggtggtcaacgtcgcttcaaaatgtggcctcacaccg
caatatgccggcctcgagcgcttgcagcagacctacgccgcccaggggttcagcgtgctc
ggcgtgccctgcaaccagtttgccgggcaggagccggatgacgaggcggccatcgcccag
ttctgcagcctgaactacggcgtgacctttccgttgagcagcaaactggaagtcaacggc
agcggtcgtcatccgctgtatcgcctgctggccggtgagggcgcggagtttcccggcgac
atcacctggaatttcgagaagtttctggtgggccaggatggccgtgtgctcgcgcgtttc
tcgccgcgcaccgcgccggatgatccggcgctgatccaggccattgagaaggccctggcc
tga

DBGET integrated database retrieval system