KEGG   Pseudomonas fulva: Psefu_3385Help
Entry
Psefu_3385        CDS       T01501                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00071  Fatty acid degradation
pfv00072  Synthesis and degradation of ketone bodies
pfv00280  Valine, leucine and isoleucine degradation
pfv00310  Lysine degradation
pfv00362  Benzoate degradation
pfv00380  Tryptophan metabolism
pfv00620  Pyruvate metabolism
pfv00630  Glyoxylate and dicarboxylate metabolism
pfv00640  Propanoate metabolism
pfv00650  Butanoate metabolism
pfv00900  Terpenoid backbone biosynthesis
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
pfv01212  Fatty acid metabolism
pfv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psefu_3385
   00630 Glyoxylate and dicarboxylate metabolism
    Psefu_3385
   00640 Propanoate metabolism
    Psefu_3385
   00650 Butanoate metabolism
    Psefu_3385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psefu_3385
   00072 Synthesis and degradation of ketone bodies
    Psefu_3385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psefu_3385
   00310 Lysine degradation
    Psefu_3385
   00380 Tryptophan metabolism
    Psefu_3385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psefu_3385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psefu_3385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psefu_3385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfv04147]
    Psefu_3385
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psefu_3385
Exosome [BR:pfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psefu_3385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEF23347
UniProt: F6ABT8
Position
3643489..3644664
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVSGARTPMGGFQGSLSSLSATDLGAAAIRAAIARVGVAASDVQEVIMGCVLPAG
LKQGPARQASLAAGLPSATGCTTINKLCGSGMKAVMLAHDLIKAGSAEVMVAGGMESMSN
APYLLPKARGGLRMGHGEVKDHMFFDGLEDARTGRLMGSFAQETADRYGITREAMDAYAI
ESLRRAQQAMQSGTLADEIVPVTVASRKGDIEVSEDEQPLNARIDKITSLKPAFSKDGSI
TAANASSISDGASALLLMSAEQAQARGLKPLARIVAHATQSQDPSEFTIAPIGAISKVLH
KAGWQKNEVDLFEINEAFAMVTMLAMQEHDLDHARVNIYGGACAQGHPVGSTGSRIIVTL
INALRQTGGKRGIASLCIGGGEATAVAVEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatattgttatcgtcagcggcgctcgcacaccgatgggtggttttcagggtagc
ctgtcttcgctaagcgcaacggatcttggtgcagcggcgattcgcgccgccatcgctcgg
gtgggtgtagcagcaagcgacgtgcaggaagtgatcatgggctgcgtactgcccgccggc
ctcaagcagggcccggcgcgccaggcatcgctggcggccggcctgccgagcgccaccgga
tgcaccaccatcaacaaactctgcggctcgggcatgaaggcggtgatgctcgcccacgac
ctgatcaaggccggcagcgccgaggtaatggtcgccggcggcatggaaagcatgtccaac
gcgccgtacttgttgcccaaggctcgcggcggcctgcgcatgggccatggcgaagtgaag
gatcacatgttcttcgatggcctggaggatgcccgcaccggccgcctgatgggctccttc
gcccaagaaaccgcggatcgctacggcatcacccgcgaagcgatggacgcctacgccatc
gaatcgctgcgccgcgcgcagcaggccatgcagtccggtacgctggccgatgagatcgtg
cccgtgaccgtggcgagccgtaagggcgatatcgaagtaagcgaagacgaacagccgttg
aacgccaggatagacaagatcaccagcctgaaaccggccttcagcaaggacggcagcatc
actgccgccaatgccagttccatttccgatggggccagcgcgttgctgctgatgagcgcc
gagcaggcccaggcccgcggcctgaaaccactggcacgcatcgttgcccacgctacccag
agtcaggaccccagcgaattcaccatcgcacccatcggcgccatcagcaaggtgctgcac
aaggccggctggcagaagaacgaagtggacctattcgagatcaatgaggccttcgccatg
gtcaccatgctggccatgcaggagcatgacctcgatcacgccagggtgaatatctacggt
ggtgcctgcgctcagggacatccggtcggctcgaccggctcgcggatcatcgtcacgctg
atcaacgccctgcgccagaccggcggcaagcgtggcatcgcgtcactgtgtatcggtggc
ggcgaggcaacggcagtcgcggttgaggtgttgtaa

DBGET integrated database retrieval system