KEGG   Pseudomonas fulva: Psefu_4035Help
Entry
Psefu_4035        CDS       T01501                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pfv  Pseudomonas fulva
Pathway
pfv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psefu_4035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pfv02022]
    Psefu_4035
Two-component system [BR:pfv02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Psefu_4035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43
Motif
Other DBs
NCBI-ProteinID: AEF23990
UniProt: F6AJ37
Position
complement(4387081..4387818)
Genome map
AA seq 245 aa AA seqDB search
MSSTAVQPVEGEKILIVDDDARLRRLLERFFDEQGYRVRAVENVEQMDRLLSRELFNLVV
LDLMLPGEDGMSACRRLRASNNQVPIIMLTAKGDEGSRIQGLEIGADDYLAKPFNPRELL
ARIKAVLRRQAPVVPGAPGSEDETVTFGDYELSLATRELKKGDEVHMLTTGEFAVLKALV
QHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDPSKPRYIQTVWGVGYVFV
PDGNK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgcagtacaaccggtcgaaggcgagaagattctgattgtcgatgacgac
gcccgtctgcgtcgtctgctcgagcgcttcttcgacgaacagggctatcgcgttcgcgcc
gtggaaaacgtcgagcagatggaccgcctgctgtcgcgcgagctgttcaacctggtggtg
ctcgacctgatgctgcctggcgaagacggcatgagcgcctgccgccgcctgcgcgcctcg
aacaatcaggtgccgatcatcatgctcaccgccaagggtgacgagggcagccgcatccag
ggtctggaaatcggtgccgacgattacctggccaaacccttcaacccgcgcgaactgctg
gcgcgcatcaaggccgtgctgcgccgccaggcgccggtggtgccgggcgcgccgggcagc
gaggacgagaccgtcaccttcggtgattacgagctgtccctggcaacgcgcgagctgaag
aagggcgacgaagtccatatgctcaccaccggcgaattcgccgtgctcaaggcgttggtg
caacatgcccgcgagccgctgacccgcgacaagctgatgaacctggcccgcggccgtgag
tgggacgccctggaacgttccatcgacgtacagatttcccgcctgcgccgcctgatcgag
ccggacccgtccaagccacgctacatccagacggtctggggtgtgggctatgtgttcgtg
ccggacggcaataaataa

DBGET integrated database retrieval system